@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK18_HUMAN: (2015-10-04 )
MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




N20_A_5(1OI9)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




N76_A_5(1OIU)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




N41_A_5(1OIY)
CDK2_HUMAN
[Raw transfer]




1RO_A_5(4EOS)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




ATP_A_5(4EOQ)
CDK2_HUMAN
[Raw transfer]




4SP_A_5(2IW8)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




GOL_C_7(3F5X)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




GOL_A_5(3F5X)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




ST8_A_5(1OGU)
CDK2_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




LZ9_A_4(4Y72)
?
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




DRK_A_3(3EB0)
?
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




GOL_A_3(2VTA)
CDK2_HUMAN
[Raw transfer]




GOL_A_2(2VTJ)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




GOL_A_3(4FKW)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




CMG_A_5(1H1P)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(4FKQ)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




JYM_A_5(4CFN)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




IMD_B_11(4AU8)
CDK5_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




13 PsiBlast_PDB 86.4953%-101 - C1 -1OGU 6.0 CDK2_HUMAN
82 PsiBlast_CBE 86.4853%-111 - C1 -2VTS 5.9 CDK2_HUMAN
25 PsiBlast_CBE 86.2853%-109 - C1 -5A14 10.5 ?
46 PsiBlast_CBE 85.9753%-110 - C1 -3WBL 5.9 CDK2_HUMAN
96 PsiBlast_CBE 85.8853%-113 - C1 -2UZN 4.0 CDK2_HUMAN
123 HHSearch 85.8657%-108 - C1 -4AU8 5.0 CDK5_HUMAN
70 PsiBlast_CBE 85.7653%-109 - C1 -2XNB 7.6 CDK2_HUMAN
86 PsiBlast_CBE 85.7553%-111 - C1 -2VTO 4.8 CDK2_HUMAN
15 PsiBlast_PDB 85.6753%-104 - C1 -1OIU 6.1 CDK2_HUMAN
57 PsiBlast_CBE 85.6553%-109 - C1 -3LFS 5.9 CDK2_HUMAN
67 PsiBlast_CBE 85.6053%-103 - C1 -3EJ1 5.9 CDK2_HUMAN
12 PsiBlast_PDB 85.6053%-111 - C1 -3EZV 6.9 CDK2_HUMAN
49 PsiBlast_CBE 85.5753%-112 - C1 -3ULI 7.3 CDK2_HUMAN
95 PsiBlast_CBE 85.5153%-108 - C1 -2UZO 5.4 CDK2_HUMAN
16 PsiBlast_PDB 85.4053%-101 - C1 -1OIY 6.0 CDK2_HUMAN
78 PsiBlast_CBE 85.3853%-109 - C1 -2W06 7.1 CDK2_HUMAN
50 PsiBlast_CBE 85.3353%-110 - C1 -3TIZ 5.6 CDK2_HUMAN
71 PsiBlast_CBE 85.2653%-108 - C1 -2XMY 6.0 CDK2_HUMAN
2 PsiBlast_PDB 85.1957%-109 - C1 -4AU8 5.0 CDK5_HUMAN
56 PsiBlast_CBE 85.1553%-111 - C1 -3NS9 6.9 CDK2_HUMAN
94 PsiBlast_CBE 85.0953%-109 - C1 -2V0D 2.4 CDK2_HUMAN
59 PsiBlast_CBE 85.0953%-115 - C1 -3LFN 7.8 CDK2_HUMAN
68 PsiBlast_CBE 85.0853%-104 - C1 -3EJ1 5.8 CDK2_HUMAN
17 PsiBlast_PDB 85.0853%-103 - C1 -4CFN 4.9 CDK2_HUMAN
51 PsiBlast_CBE 85.0453%-113 - C1 -3TIY 3.7 CDK2_HUMAN
14 PsiBlast_PDB 85.0453%-104 - C1 -1OI9 6.3 CDK2_HUMAN
44 PsiBlast_CBE 85.0153%-115 - C1 -4BZD 7.2 CDK2_HUMAN
93 PsiBlast_CBE 84.9653%-112 - C1 -2VTA 3.1 CDK2_HUMAN
48 PsiBlast_CBE 84.9553%-109 - C1 -3UNJ 6.9 CDK2_HUMAN
10 PsiBlast_PDB 84.9553%-103 - C1 -2IW8 6.8 CDK2_HUMAN
92 PsiBlast_CBE 84.9453%-113 - C1 -2VTH 3.4 CDK2_HUMAN
45 PsiBlast_CBE 84.8053%-117 - C1 -4BGH 5.7 CDK2_HUMAN
20 PsiBlast_PDB 84.8053%-103 - C1 -1H1P 5.2 CDK2_HUMAN
18 PsiBlast_PDB 84.7953%-100 - C1 -4EOS 4.9 CDK2_HUMAN
79 PsiBlast_CBE 84.7653%-117 - C1 -2W05 6.7 CDK2_HUMAN
52 PsiBlast_CBE 84.7053%-112 - C1 -3TI1 6.3 CDK2_HUMAN
43 PsiBlast_CBE 84.7053%-112 - C1 -4D1X 4.9 CDK2_HUMAN
11 PsiBlast_PDB 84.7053%-115 - C1 -3EZR 7.0 CDK2_HUMAN
91 PsiBlast_CBE 84.6953%-115 - C1 -2VTI 5.1 CDK2_HUMAN
89 PsiBlast_CBE 84.6953%-110 - C1 -2VTL 3.6 CDK2_HUMAN
63 PsiBlast_CBE 84.4753%-102 - C1 -3F5X 8.5 CDK2_HUMAN
99 PsiBlast_CBE 84.4253%-114 - C1 -2R64 4.5 CDK2_HUMAN
81 PsiBlast_CBE 84.3653%-108 - C1 -2VU3 6.2 CDK2_HUMAN
19 PsiBlast_PDB 84.3653%-103 - C1 -4EOQ 4.2 CDK2_HUMAN
47 PsiBlast_CBE 84.3553%-105 - C1 -3UNK 6.7 CDK2_HUMAN
26 PsiBlast_CBE 84.3353%-105 - C1 -4LYN 5.8 CDK2_HUMAN
69 PsiBlast_CBE 84.3253%-107 - C1 -3EID 7.1 CDK2_HUMAN
90 PsiBlast_CBE 84.2653%-115 - C1 -2VTJ 4.1 CDK2_HUMAN
76 PsiBlast_CBE 84.2153%-108 - C1 -2W1H 6.6 CDK2_HUMAN
55 PsiBlast_CBE 84.1453%-112 - C1 -3S2P 4.2 CDK2_HUMAN
85 PsiBlast_CBE 84.1253%-112 - C1 -2VTP 4.4 CDK2_HUMAN
62 PsiBlast_CBE 84.1053%-109 - C1 -3FZ1 3.7 CDK2_HUMAN
21 PsiBlast_CBE 84.0657%-115 - C1 -4AU8 4.8 CDK5_HUMAN
87 PsiBlast_CBE 83.9053%-113 - C1 -2VTN 4.2 CDK2_HUMAN
5 PsiBlast_PDB 83.6956%-112 - C1 -1UNL 6.4 CDK5_HUMAN
65 PsiBlast_CBE 83.6653%-104 - C1 -3EOC 4.4 CDK2_HUMAN
97 PsiBlast_CBE 83.6153%-102 - C1 -2UUE 6.0 CDK2_HUMAN
27 PsiBlast_CBE 83.6053%-109 - C1 -4KD1 8.0 CDK2_HUMAN
83 PsiBlast_CBE 83.5653%-109 - C1 -2VTR 5.0 CDK2_HUMAN
64 PsiBlast_CBE 83.5353%-106 - C1 -3F5X 7.9 CDK2_HUMAN
98 PsiBlast_CBE 83.4753% -99 - C1 -2UUE 5.1 CDK2_HUMAN
66 PsiBlast_CBE 83.4553%-103 - C1 -3EOC 6.4 CDK2_HUMAN
58 PsiBlast_CBE 83.2353%-112 - C1 -3LFQ 5.7 CDK2_HUMAN
75 PsiBlast_CBE 83.2153%-100 - C1 -2WEV 6.2 CDK2_HUMAN
28 PsiBlast_CBE 83.1853% -99 - C1 -4FX3 6.6 CDK2_HUMAN
29 PsiBlast_CBE 83.0353%-102 - C1 -4FX3 6.7 CDK2_HUMAN
74 PsiBlast_CBE 83.0253%-103 - C1 -2WEV 6.2 CDK2_HUMAN
72 PsiBlast_CBE 82.9553%-102 - C1 -2X1N 6.4 CDK2_HUMAN
88 PsiBlast_CBE 82.9353%-108 - C1 -2VTM 3.4 CDK2_HUMAN
73 PsiBlast_CBE 82.6453% -99 - C1 -2X1N 6.8 CDK2_HUMAN
24 PsiBlast_CBE 82.5253%-117 - C1 -5D1J 6.6 ?
3 PsiBlast_PDB 82.4356%-116 - C1 -1UNG 5.0 CDK5_HUMAN
128 HHSearch 82.3251%-108 - C1 -3NIZ 4.8 ?
84 PsiBlast_CBE 82.2353%-114 - C1 -2VTQ 5.6 CDK2_HUMAN
22 PsiBlast_CBE 82.1756%-117 - C1 -3O0G 6.4 CDK5_HUMAN
8 PsiBlast_PDB 81.2950%-106 - C1 -4Y72 7.0 ?
113 HHSearch 74.0630% -99 - C1 -3EB0 6.4 ?
130 HHSearch 73.8634%-103 - C1 -2B9H 5.6 FUS3_YEAST
122 HHSearch 70.5931% -99 - C1 -1J1B 4.3 GSK3B_HUMAN
115 HHSearch 70.2040% -95 - C1 -1UA2 4.9 CDK7_HUMAN
132 HHSearch 68.9136%-106 - C1 -4BGQ 8.0 CDKL5_HUMAN
131 HHSearch 67.0635%-113 - C1 -2FST - MK14_HUMAN
133 HHSearch 66.2336%-114 - C1 -4F6U 9.1 CDK8_HUMAN
33 PsiBlast_CBE 61.6253% -2 - C1 -4FKQ Error CDK2_HUMAN
35 PsiBlast_CBE 61.4053% 4 - C1 -4FKO Error CDK2_HUMAN
60 PsiBlast_CBE 59.6653% 7 - C1 -3IGG Error CDK2_HUMAN
77 PsiBlast_CBE 52.3053% 2 - C1 -2W17 3.7 CDK2_HUMAN
31 PsiBlast_CBE 52.0953% 0 - C1 -4FKV 1.3 CDK2_HUMAN
40 PsiBlast_CBE 52.0353% 3 - C1 -4EK6 2.8 CDK2_HUMAN
53 PsiBlast_CBE 51.9053% -1 - C1 -3SW7 4.3 CDK2_HUMAN
80 PsiBlast_CBE 51.8153% 1 - C1 -2VV9 3.9 CDK2_HUMAN
37 PsiBlast_CBE 51.5653% 1 - C1 -4FKJ 2.3 CDK2_HUMAN
30 PsiBlast_CBE 51.2753% 3 - C1 -4FKW 2.1 CDK2_HUMAN
38 PsiBlast_CBE 51.2053% 8 - C1 -4FKG 3.4 CDK2_HUMAN
32 PsiBlast_CBE 50.9353% 0 - C1 -4FKR 3.3 CDK2_HUMAN
120 HHSearch 49.9054% 7 - C1 -4EK4 2.8 CDK2_HUMAN
41 PsiBlast_CBE 49.8653% 7 - C1 -4EK5 2.3 CDK2_HUMAN
42 PsiBlast_CBE 49.4653% 9 - C1 -4EK4 2.8 CDK2_HUMAN
61 PsiBlast_CBE 48.3353% 7 - C1 -3IG7 2.5 CDK2_HUMAN