@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK4_HUMAN: (2015-10-05 )
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Atome Classification :

(74 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




ANP_A_7(1CM8)
MK12_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




DRK_A_3(3EB0)
?
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




GOL_A_5(3F5X)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




GOL_C_7(3F5X)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




BOG_X_3(2FST)
MK14_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




78 PsiBlast_CBE 80.6145%-130 - C1 -2W06 7.3 CDK2_HUMAN
91 PsiBlast_CBE 80.4045%-131 - C1 -2VTI 5.3 CDK2_HUMAN
43 PsiBlast_CBE 80.1445%-132 - C1 -4D1X 4.8 CDK2_HUMAN
92 PsiBlast_CBE 79.9745%-131 - C1 -2VTH 3.4 CDK2_HUMAN
70 PsiBlast_CBE 79.7645%-129 - C1 -2XNB 7.6 CDK2_HUMAN
66 PsiBlast_CBE 79.7645%-129 - C1 -3EOC 7.0 CDK2_HUMAN
56 PsiBlast_CBE 79.7245%-131 - C1 -3NS9 7.5 CDK2_HUMAN
86 PsiBlast_CBE 79.7145%-128 - C1 -2VTO 4.4 CDK2_HUMAN
71 PsiBlast_CBE 79.6945%-125 - C1 -2XMY 6.2 CDK2_HUMAN
94 PsiBlast_CBE 79.6745%-130 - C1 -2V0D 2.3 CDK2_HUMAN
55 PsiBlast_CBE 79.6445%-130 - C1 -3S2P 4.4 CDK2_HUMAN
49 PsiBlast_CBE 79.5145%-130 - C1 -3ULI 6.9 CDK2_HUMAN
97 PsiBlast_CBE 79.3845%-127 - C1 -2UUE 5.7 CDK2_HUMAN
85 PsiBlast_CBE 79.3845%-130 - C1 -2VTP 4.8 CDK2_HUMAN
68 PsiBlast_CBE 79.3345%-130 - C1 -3EJ1 5.9 CDK2_HUMAN
95 PsiBlast_CBE 79.2845%-129 - C1 -2UZO 5.0 CDK2_HUMAN
51 PsiBlast_CBE 79.2845%-132 - C1 -3TIY - CDK2_HUMAN
72 PsiBlast_CBE 79.2545%-126 - C1 -2X1N 6.3 CDK2_HUMAN
63 PsiBlast_CBE 79.2545%-128 - C1 -3F5X 8.3 CDK2_HUMAN
59 PsiBlast_CBE 79.2545%-128 - C1 -3LFN 7.8 CDK2_HUMAN
47 PsiBlast_CBE 79.2545%-126 - C1 -3UNK 6.7 CDK2_HUMAN
48 PsiBlast_CBE 79.1845%-132 - C1 -3UNJ 6.8 CDK2_HUMAN
46 PsiBlast_CBE 79.0845%-129 - C1 -3WBL 5.8 CDK2_HUMAN
99 PsiBlast_CBE 79.0245%-132 - C1 -2R64 5.2 CDK2_HUMAN
50 PsiBlast_CBE 78.9945%-129 - C1 -3TIZ 5.4 CDK2_HUMAN
96 PsiBlast_CBE 78.8845%-128 - C1 -2UZN 4.5 CDK2_HUMAN
64 PsiBlast_CBE 78.8845%-130 - C1 -3F5X 7.7 CDK2_HUMAN
57 PsiBlast_CBE 78.7645%-130 - C1 -3LFS 5.6 CDK2_HUMAN
82 PsiBlast_CBE 78.6545%-129 - C1 -2VTS 6.3 CDK2_HUMAN
76 PsiBlast_CBE 78.6245%-125 - C1 -2W1H 6.6 CDK2_HUMAN
98 PsiBlast_CBE 78.6145%-128 - C1 -2UUE 4.7 CDK2_HUMAN
67 PsiBlast_CBE 78.5645%-129 - C1 -3EJ1 5.6 CDK2_HUMAN
58 PsiBlast_CBE 78.5045%-130 - C1 -3LFQ 5.6 CDK2_HUMAN
65 PsiBlast_CBE 78.3245%-130 - C1 -3EOC 5.9 CDK2_HUMAN
62 PsiBlast_CBE 78.1745%-127 - C1 -3FZ1 3.7 CDK2_HUMAN
75 PsiBlast_CBE 78.1645%-127 - C1 -2WEV 5.5 CDK2_HUMAN
83 PsiBlast_CBE 78.1345%-126 - C1 -2VTR 5.3 CDK2_HUMAN
44 PsiBlast_CBE 78.0545%-127 - C1 -4BZD 7.7 CDK2_HUMAN
93 PsiBlast_CBE 77.9145%-126 - C1 -2VTA 3.1 CDK2_HUMAN
87 PsiBlast_CBE 77.8745%-122 - C1 -2VTN 3.9 CDK2_HUMAN
69 PsiBlast_CBE 77.8745%-131 - C1 -3EID 7.7 CDK2_HUMAN
45 PsiBlast_CBE 77.6945%-127 - C1 -4BGH 6.0 CDK2_HUMAN
88 PsiBlast_CBE 77.6645%-129 - C1 -2VTM 3.3 CDK2_HUMAN
73 PsiBlast_CBE 77.4545%-127 - C1 -2X1N 6.2 CDK2_HUMAN
74 PsiBlast_CBE 77.3245%-126 - C1 -2WEV 6.4 CDK2_HUMAN
79 PsiBlast_CBE 76.9045%-127 - C1 -2W05 7.2 CDK2_HUMAN
89 PsiBlast_CBE 76.8845%-125 - C1 -2VTL 3.2 CDK2_HUMAN
90 PsiBlast_CBE 76.7045%-124 - C1 -2VTJ 4.4 CDK2_HUMAN
84 PsiBlast_CBE 75.9945%-128 - C1 -2VTQ 5.5 CDK2_HUMAN
124 HHSearch 75.2946%-120 - C1 -4AU8 5.3 CDK5_HUMAN
81 PsiBlast_CBE 75.1345%-126 - C1 -2VU3 6.3 CDK2_HUMAN
127 HHSearch 73.6335%-114 - C1 -2B9H 4.6 FUS3_YEAST
116 HHSearch 72.6739%-102 - C1 -3N9X 2.3 ?
130 HHSearch 69.8535%-109 - C1 -4BGQ 8.0 CDKL5_HUMAN
117 HHSearch 69.6730%-123 - C1 -3EB0 5.9 ?
115 HHSearch 67.0338%-108 - C1 -1UA2 4.9 CDK7_HUMAN
122 HHSearch 65.8237%-115 - C1 -1CM8 4.8 MK12_HUMAN
119 HHSearch 65.7635%-110 - C1 -4IC7 4.9 MK07_HUMAN
126 HHSearch 65.5636% -99 - C1 -3TTJ 7.0 MK10_HUMAN
128 HHSearch 65.3536%-115 - C1 -2FST 2.9 MK14_HUMAN
35 PsiBlast_CBE 48.6545% -13 - C1 -4FKO Error CDK2_HUMAN
114 HHSearch 44.5847% -6 - C1 -4EK4 3.4 CDK2_HUMAN
38 PsiBlast_CBE 42.8945% -8 - C1 -4FKG 3.6 CDK2_HUMAN
60 PsiBlast_CBE 42.8445% -14 - C1 -3IGG 4.0 CDK2_HUMAN
31 PsiBlast_CBE 42.7745% -9 - C1 -4FKV 2.2 CDK2_HUMAN
33 PsiBlast_CBE 42.0045% -12 - C1 -4FKQ 4.5 CDK2_HUMAN
40 PsiBlast_CBE 41.5245% -11 - C1 -4EK6 4.2 CDK2_HUMAN
41 PsiBlast_CBE 41.4745% -13 - C1 -4EK5 3.4 CDK2_HUMAN
32 PsiBlast_CBE 40.7545% -9 - C1 -4FKR 5.5 CDK2_HUMAN
37 PsiBlast_CBE 40.3745% -10 - C1 -4FKJ 3.3 CDK2_HUMAN
61 PsiBlast_CBE 39.8345% -8 - C1 -3IG7 4.0 CDK2_HUMAN
80 PsiBlast_CBE 39.7245% -6 - C1 -2VV9 4.3 CDK2_HUMAN
53 PsiBlast_CBE 39.5045% -10 - C1 -3SW7 4.1 CDK2_HUMAN
77 PsiBlast_CBE 38.9945% -6 - C1 -2W17 2.8 CDK2_HUMAN