@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK6_HUMAN: (2015-10-05 )
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Atome Classification :

(96 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LQQ_B_5(2EUF)
CDK6_HUMAN
[Raw transfer]




24V_B_3(4TTH)
CDK6_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




3NV_A_2(3NUX)
CDK6_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




404_A_2(3PJ8)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




0RS_A_2(4EZ5)
CDK6_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




HDT_A_2(1OIT)
CDK2_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




4AU_A_2(4AUA)
CDK6_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




AP9_B_4(2F2C)
CDK6_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




1PU_B_2(1GII)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




FSE_C_3(1XO2)
CDK6_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




DRK_A_3(3EB0)
?
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




2PU_B_2(1GIJ)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




12 PsiBlast_PDB 92.26100%-136 - C1 -4EZ5 8.0 CDK6_HUMAN
10 PsiBlast_PDB 92.25100%-133 - C1 -3NUX 6.9 CDK6_HUMAN
7 PsiBlast_PDB 92.11100%-128 - C1 -1XO2 6.0 CDK6_HUMAN
11 PsiBlast_PDB 90.49100%-136 - C1 -4AUA 4.9 CDK6_HUMAN
8 PsiBlast_PDB 90.20100%-130 - C1 -2EUF 8.2 CDK6_HUMAN
9 PsiBlast_PDB 89.64100%-129 - C1 -2F2C 6.0 CDK6_HUMAN
5 PsiBlast_PDB 87.04100%-134 - C1 -4TTH 7.1 CDK6_HUMAN
87 PsiBlast_CBE 79.9748%-120 - C1 -2VTO 4.4 CDK2_HUMAN
44 PsiBlast_CBE 79.6348%-125 - C1 -4D1X 4.8 CDK2_HUMAN
63 PsiBlast_CBE 79.1348%-118 - C1 -3FZ1 3.7 CDK2_HUMAN
57 PsiBlast_CBE 79.0848%-122 - C1 -3NS9 7.5 CDK2_HUMAN
79 PsiBlast_CBE 78.8848%-122 - C1 -2W06 7.4 CDK2_HUMAN
19 PsiBlast_PDB 78.6549%-119 - C1 -1GIJ 7.0 CDK2_HUMAN
60 PsiBlast_CBE 78.5848%-118 - C1 -3LFN 7.8 CDK2_HUMAN
24 PsiBlast_CBE 78.4548%-119 - C1 -3PJ8 6.4 CDK2_HUMAN
27 PsiBlast_CBE 78.4448%-116 - C1 -4LYN 6.3 CDK2_HUMAN
94 PsiBlast_CBE 78.3148%-118 - C1 -2VTA 3.1 CDK2_HUMAN
28 PsiBlast_CBE 78.2748%-117 - C1 -4KD1 8.4 CDK2_HUMAN
93 PsiBlast_CBE 78.2648%-123 - C1 -2VTH 3.4 CDK2_HUMAN
50 PsiBlast_CBE 78.2448%-120 - C1 -3ULI 6.9 CDK2_HUMAN
46 PsiBlast_CBE 78.2448%-120 - C1 -4BGH 6.1 CDK2_HUMAN
83 PsiBlast_CBE 78.2148%-120 - C1 -2VTS 6.3 CDK2_HUMAN
92 PsiBlast_CBE 78.1848%-122 - C1 -2VTI 5.3 CDK2_HUMAN
97 PsiBlast_CBE 78.1548%-125 - C1 -2UZN 4.6 CDK2_HUMAN
86 PsiBlast_CBE 78.1348%-119 - C1 -2VTP 4.8 CDK2_HUMAN
18 PsiBlast_PDB 78.0949%-121 - C1 -1GII 5.9 CDK2_HUMAN
23 PsiBlast_CBE 78.0848%-118 - C1 -3EZR 6.4 CDK2_HUMAN
72 PsiBlast_CBE 78.0648%-116 - C1 -2XMY 6.2 CDK2_HUMAN
56 PsiBlast_CBE 78.0548%-123 - C1 -3S2P 4.5 CDK2_HUMAN
100 PsiBlast_CBE 78.0448%-123 - C1 -2R64 5.2 CDK2_HUMAN
69 PsiBlast_CBE 78.0448%-122 - C1 -3EJ1 5.9 CDK2_HUMAN
59 PsiBlast_CBE 77.9348%-119 - C1 -3LFQ 5.7 CDK2_HUMAN
30 PsiBlast_CBE 77.8948%-119 - C1 -4FX3 6.7 CDK2_HUMAN
29 PsiBlast_CBE 77.8048%-116 - C1 -4FX3 6.8 CDK2_HUMAN
70 PsiBlast_CBE 77.7648%-123 - C1 -3EID 7.3 CDK2_HUMAN
66 PsiBlast_CBE 77.6648%-121 - C1 -3EOC 5.9 CDK2_HUMAN
58 PsiBlast_CBE 77.6448%-120 - C1 -3LFS 5.6 CDK2_HUMAN
95 PsiBlast_CBE 77.6348%-123 - C1 -2V0D 2.4 CDK2_HUMAN
65 PsiBlast_CBE 77.6048%-120 - C1 -3F5X 7.6 CDK2_HUMAN
64 PsiBlast_CBE 77.5848%-119 - C1 -3F5X 8.3 CDK2_HUMAN
91 PsiBlast_CBE 77.5548%-118 - C1 -2VTJ 4.3 CDK2_HUMAN
67 PsiBlast_CBE 77.5548%-121 - C1 -3EOC 7.0 CDK2_HUMAN
47 PsiBlast_CBE 77.5248%-120 - C1 -3WBL 5.9 CDK2_HUMAN
77 PsiBlast_CBE 77.4848%-116 - C1 -2W1H 6.6 CDK2_HUMAN
22 PsiBlast_CBE 77.4448%-115 - C1 -3EZV 7.0 CDK2_HUMAN
71 PsiBlast_CBE 77.4248%-115 - C1 -2XNB 7.6 CDK2_HUMAN
84 PsiBlast_CBE 77.3548%-119 - C1 -2VTR 5.3 CDK2_HUMAN
52 PsiBlast_CBE 77.3448%-118 - C1 -3TIY 3.7 CDK2_HUMAN
90 PsiBlast_CBE 77.3248%-116 - C1 -2VTL 3.2 CDK2_HUMAN
53 PsiBlast_CBE 77.3048%-118 - C1 -3TI1 6.2 CDK2_HUMAN
96 PsiBlast_CBE 77.2848%-120 - C1 -2UZO 5.0 CDK2_HUMAN
51 PsiBlast_CBE 77.2748%-120 - C1 -3TIZ 5.4 CDK2_HUMAN
99 PsiBlast_CBE 77.1648%-117 - C1 -2UUE 4.7 CDK2_HUMAN
73 PsiBlast_CBE 77.1648%-118 - C1 -2X1N 6.3 CDK2_HUMAN
45 PsiBlast_CBE 77.0948%-118 - C1 -4BZD 7.5 CDK2_HUMAN
68 PsiBlast_CBE 77.0848%-121 - C1 -3EJ1 5.6 CDK2_HUMAN
49 PsiBlast_CBE 77.0548%-119 - C1 -3UNJ 6.8 CDK2_HUMAN
98 PsiBlast_CBE 77.0248%-116 - C1 -2UUE 5.9 CDK2_HUMAN
75 PsiBlast_CBE 77.0148%-113 - C1 -2WEV 6.4 CDK2_HUMAN
85 PsiBlast_CBE 76.9848%-119 - C1 -2VTQ 5.5 CDK2_HUMAN
21 PsiBlast_CBE 76.9748%-124 - C1 -1OIT 6.2 CDK2_HUMAN
26 PsiBlast_CBE 76.7248%-118 - C1 -5A14 9.8 ?
48 PsiBlast_CBE 76.7048%-116 - C1 -3UNK 6.7 CDK2_HUMAN
80 PsiBlast_CBE 76.4848%-119 - C1 -2W05 7.0 CDK2_HUMAN
74 PsiBlast_CBE 76.4848%-118 - C1 -2X1N 6.2 CDK2_HUMAN
89 PsiBlast_CBE 76.3148%-119 - C1 -2VTM 3.3 CDK2_HUMAN
76 PsiBlast_CBE 76.2148%-119 - C1 -2WEV 5.5 CDK2_HUMAN
88 PsiBlast_CBE 74.9848%-113 - C1 -2VTN 3.9 CDK2_HUMAN
82 PsiBlast_CBE 74.9148%-115 - C1 -2VU3 6.2 CDK2_HUMAN
132 HHSearch 74.5449%-117 - C1 -3NIZ 4.3 ?
25 PsiBlast_CBE 74.4748%-121 - C1 -5D1J 6.5 ?
125 HHSearch 74.1636%-106 - C1 -2B9H 4.6 FUS3_YEAST
124 HHSearch 73.9848%-114 - C1 -4AU8 5.3 CDK5_HUMAN
115 HHSearch 71.1637% -99 - C1 -3N9X 2.3 ?
118 HHSearch 67.3832%-119 - C1 -3EB0 6.0 ?
119 HHSearch 66.6735%-106 - C1 -4IC7 4.9 MK07_HUMAN
116 HHSearch 65.7038%-100 - C1 -1UA2 4.9 CDK7_HUMAN
133 HHSearch 65.4936%-105 - C1 -4BGQ 7.8 CDKL5_HUMAN
127 HHSearch 60.6135% -95 - C1 -3TTJ 7.0 MK10_HUMAN
128 HHSearch 60.0435%-106 - C1 -2FST - MK14_HUMAN
78 PsiBlast_CBE 45.1048% 3 - C1 -2W17 2.9 CDK2_HUMAN
61 PsiBlast_CBE 44.6548% 3 - C1 -3IGG 3.5 CDK2_HUMAN
36 PsiBlast_CBE 43.8248% -0 - C1 -4FKO 3.3 CDK2_HUMAN
54 PsiBlast_CBE 43.7448% 2 - C1 -3SW7 4.1 CDK2_HUMAN
42 PsiBlast_CBE 43.6448% 3 - C1 -4EK5 3.3 CDK2_HUMAN
114 HHSearch 43.5650% 7 - C1 -4EK4 3.4 CDK2_HUMAN
81 PsiBlast_CBE 43.5648% 3 - C1 -2VV9 4.5 CDK2_HUMAN
43 PsiBlast_CBE 42.9348% 6 - C1 -4EK4 3.4 CDK2_HUMAN
34 PsiBlast_CBE 42.9248% 1 - C1 -4FKQ 4.4 CDK2_HUMAN
32 PsiBlast_CBE 42.8148% 2 - C1 -4FKV 2.2 CDK2_HUMAN
38 PsiBlast_CBE 42.6548% 3 - C1 -4FKJ 3.6 CDK2_HUMAN
41 PsiBlast_CBE 42.5848% 2 - C1 -4EK6 4.6 CDK2_HUMAN
31 PsiBlast_CBE 42.5548% 4 - C1 -4FKW 2.2 CDK2_HUMAN
39 PsiBlast_CBE 42.4548% 7 - C1 -4FKG 3.8 CDK2_HUMAN
62 PsiBlast_CBE 42.3148% 4 - C1 -3IG7 4.8 CDK2_HUMAN
33 PsiBlast_CBE 42.1748% 4 - C1 -4FKR 6.4 CDK2_HUMAN