@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDKL1_HUMAN: (2015-10-05 )
MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

Atome Classification :

(101 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

D15_C_6(4AGU)
CDKL1_HUMAN
[Raw transfer]




D15_A_4(4AGU)
CDKL1_HUMAN
[Raw transfer]




D15_A_4(4AGU)
CDKL1_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




D15_B_5(4AGU)
CDKL1_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




HDT_A_2(1OIT)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




4SP_A_5(2IW8)
CDK2_HUMAN
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




I17_B_2(1G5S)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




LIG_B_2(1JVP)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




TC0_B_7(4BBM)
CDKL2_HUMAN
[Raw transfer]




107_E_5(1FVV)
CDK2_HUMAN
[Raw transfer]




ANP_A_4(4QNY)
?
[Raw transfer]




1PU_B_2(1GIH)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




TC0_A_3(4BBM)
CDKL2_HUMAN
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




DKI_A_2(4AAA)
CDKL2_HUMAN
[Raw transfer]




DKI_A_2(4AAA)
CDKL2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




106_A_2(1FVT)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




DTQ_B_2(1DI8)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




PVB_A_2(1CKP)
CDK2_HUMAN
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1FIN)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(1CKP)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(4AAA)
CDKL2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




EDO_A_13(3TIY)
CDK2_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




21 PsiBlast_CBE 97.8898%-133 - C1 -4AGU 7.9 CDKL1_HUMAN
110 HHSearch 97.8198%-134 - C1 -4AGU 8.7 CDKL1_HUMAN
1 PsiBlast_PDB 97.8198%-134 - C1 -4AGU 8.7 CDKL1_HUMAN
22 PsiBlast_CBE 96.1198%-135 - C1 -4AGU 7.3 CDKL1_HUMAN
111 HHSearch 79.4157%-132 - C1 -4AAA 7.1 CDKL2_HUMAN
2 PsiBlast_PDB 78.4757%-135 - C1 -4AAA 7.1 CDKL2_HUMAN
3 PsiBlast_PDB 77.6057%-134 - C1 -4BBM 5.8 CDKL2_HUMAN
4 PsiBlast_PDB 74.4948%-115 - C1 -3ZDU 7.9 CDKL3_HUMAN
23 PsiBlast_CBE 73.8257%-136 - C1 -4BBM 8.8 CDKL2_HUMAN
113 HHSearch 72.7449%-118 - C1 -3ZDU 7.9 CDKL3_HUMAN
15 PsiBlast_PDB 72.5239%-123 - C1 -1FVT 5.3 CDK2_HUMAN
26 PsiBlast_CBE 72.1539%-120 - C1 -4LYN 4.9 CDK2_HUMAN
99 PsiBlast_CBE 72.1039%-124 - C1 -2R64 4.9 CDK2_HUMAN
112 HHSearch 71.8047%-127 - C1 -4BGQ 8.3 CDKL5_HUMAN
92 PsiBlast_CBE 71.8039%-123 - C1 -2VTH 3.2 CDK2_HUMAN
78 PsiBlast_CBE 71.7939%-124 - C1 -2W06 7.0 CDK2_HUMAN
58 PsiBlast_CBE 71.7939%-119 - C1 -3LFQ 5.8 CDK2_HUMAN
19 PsiBlast_PDB 71.7039%-122 - C1 -1JVP 5.5 CDK2_HUMAN
62 PsiBlast_CBE 71.6839%-123 - C1 -3FZ1 3.5 CDK2_HUMAN
91 PsiBlast_CBE 71.6339%-124 - C1 -2VTI 4.5 CDK2_HUMAN
86 PsiBlast_CBE 71.6039%-122 - C1 -2VTO 4.6 CDK2_HUMAN
11 PsiBlast_PDB 71.5739%-124 - C1 -1CKP 5.3 CDK2_HUMAN
5 PsiBlast_PDB 71.3347%-128 - C1 -4BGQ 8.3 CDKL5_HUMAN
82 PsiBlast_CBE 71.2739%-120 - C1 -2VTS 6.1 CDK2_HUMAN
93 PsiBlast_CBE 71.0139%-123 - C1 -2VTA 2.8 CDK2_HUMAN
96 PsiBlast_CBE 70.9739%-126 - C1 -2UZN 4.7 CDK2_HUMAN
57 PsiBlast_CBE 70.8939%-119 - C1 -3LFS 5.7 CDK2_HUMAN
71 PsiBlast_CBE 70.7039%-116 - C1 -2XMY 5.7 CDK2_HUMAN
95 PsiBlast_CBE 70.6139%-115 - C1 -2UZO 4.6 CDK2_HUMAN
27 PsiBlast_CBE 70.5839%-115 - C1 -4KD1 7.5 CDK2_HUMAN
47 PsiBlast_CBE 70.5439%-118 - C1 -3UNK 6.9 CDK2_HUMAN
51 PsiBlast_CBE 70.4639%-120 - C1 -3TIY 3.8 CDK2_HUMAN
83 PsiBlast_CBE 70.4139%-115 - C1 -2VTR 4.7 CDK2_HUMAN
46 PsiBlast_CBE 70.3439%-121 - C1 -3WBL 5.9 CDK2_HUMAN
43 PsiBlast_CBE 70.1839%-124 - C1 -4D1X 4.7 CDK2_HUMAN
76 PsiBlast_CBE 70.1239%-119 - C1 -2W1H 6.0 CDK2_HUMAN
90 PsiBlast_CBE 70.0139%-117 - C1 -2VTJ 4.3 CDK2_HUMAN
50 PsiBlast_CBE 69.9939%-121 - C1 -3TIZ 4.6 CDK2_HUMAN
59 PsiBlast_CBE 69.9739%-123 - C1 -3LFN 6.9 CDK2_HUMAN
89 PsiBlast_CBE 69.8739%-117 - C1 -2VTL 3.7 CDK2_HUMAN
55 PsiBlast_CBE 69.8439%-120 - C1 -3S2P 4.3 CDK2_HUMAN
56 PsiBlast_CBE 69.6439%-122 - C1 -3NS9 6.9 CDK2_HUMAN
13 PsiBlast_PDB 69.5339%-125 - C1 -1DI8 6.2 CDK2_HUMAN
48 PsiBlast_CBE 69.5139%-117 - C1 -3UNJ 6.7 CDK2_HUMAN
49 PsiBlast_CBE 69.3439%-122 - C1 -3ULI 6.8 CDK2_HUMAN
88 PsiBlast_CBE 69.3139%-116 - C1 -2VTM 3.2 CDK2_HUMAN
16 PsiBlast_PDB 69.2839%-113 - C1 -1FVV 6.4 CDK2_HUMAN
85 PsiBlast_CBE 69.2739%-121 - C1 -2VTP 5.0 CDK2_HUMAN
20 PsiBlast_PDB 69.2739%-118 - C1 -1GIH 6.7 CDK2_HUMAN
97 PsiBlast_CBE 69.2539%-111 - C1 -2UUE 4.9 CDK2_HUMAN
8 PsiBlast_PDB 69.1639%-119 - C1 -3EZV 7.3 CDK2_HUMAN
70 PsiBlast_CBE 69.0939%-116 - C1 -2XNB 5.7 CDK2_HUMAN
69 PsiBlast_CBE 68.8839%-115 - C1 -3EID 7.8 CDK2_HUMAN
68 PsiBlast_CBE 68.8639%-113 - C1 -3EJ1 6.2 CDK2_HUMAN
52 PsiBlast_CBE 68.8439%-119 - C1 -3TI1 6.7 CDK2_HUMAN
45 PsiBlast_CBE 68.8139%-118 - C1 -4BGH 5.6 CDK2_HUMAN
44 PsiBlast_CBE 68.7839%-118 - C1 -4BZD 7.3 CDK2_HUMAN
79 PsiBlast_CBE 68.6439%-121 - C1 -2W05 6.4 CDK2_HUMAN
72 PsiBlast_CBE 68.5839%-110 - C1 -2X1N 6.3 CDK2_HUMAN
28 PsiBlast_CBE 68.5339%-112 - C1 -4FX3 7.0 CDK2_HUMAN
74 PsiBlast_CBE 68.4539%-111 - C1 -2WEV 6.4 CDK2_HUMAN
18 PsiBlast_PDB 68.3639%-121 - C1 -1G5S 8.6 CDK2_HUMAN
94 PsiBlast_CBE 68.2539%-116 - C1 -2V0D 2.4 CDK2_HUMAN
29 PsiBlast_CBE 68.0639%-114 - C1 -4FX3 6.5 CDK2_HUMAN
98 PsiBlast_CBE 68.0139%-111 - C1 -2UUE 4.7 CDK2_HUMAN
81 PsiBlast_CBE 67.8639%-115 - C1 -2VU3 6.2 CDK2_HUMAN
7 PsiBlast_PDB 67.8139%-119 - C1 -3EZR 6.7 CDK2_HUMAN
9 PsiBlast_PDB 67.7539%-113 - C1 -2IW8 6.5 CDK2_HUMAN
87 PsiBlast_CBE 67.7239%-115 - C1 -2VTN 4.2 CDK2_HUMAN
67 PsiBlast_CBE 67.6739%-112 - C1 -3EJ1 5.5 CDK2_HUMAN
84 PsiBlast_CBE 67.5539%-120 - C1 -2VTQ 5.6 CDK2_HUMAN
63 PsiBlast_CBE 67.5539%-114 - C1 -3F5X 7.8 CDK2_HUMAN
73 PsiBlast_CBE 67.5139%-110 - C1 -2X1N 6.4 CDK2_HUMAN
6 PsiBlast_PDB 67.4739%-120 - C1 -1OIT 5.1 CDK2_HUMAN
66 PsiBlast_CBE 67.4439%-111 - C1 -3EOC 6.9 CDK2_HUMAN
25 PsiBlast_CBE 67.3739%-115 - C1 -5A14 10.5 ?
65 PsiBlast_CBE 67.2939%-112 - C1 -3EOC 5.9 CDK2_HUMAN
75 PsiBlast_CBE 67.2339%-112 - C1 -2WEV 5.6 CDK2_HUMAN
10 PsiBlast_PDB 66.4239%-110 - C1 -1FIN 3.7 CDK2_HUMAN
64 PsiBlast_CBE 66.0739%-114 - C1 -3F5X 7.4 CDK2_HUMAN
129 HHSearch 65.0640%-112 - C1 -4AU8 3.6 CDK5_HUMAN
125 HHSearch 64.6533%-123 - C1 -2B9H 5.2 FUS3_YEAST
130 HHSearch 64.4431%-106 - C1 -4QNY 5.0 ?
24 PsiBlast_CBE 64.1039%-121 - C1 -5D1J 6.5 ?
115 HHSearch 62.8339%-109 - C1 -1UA2 5.3 CDK7_HUMAN
126 HHSearch 62.5637%-116 - C1 -1J1B 4.3 GSK3B_HUMAN
42 PsiBlast_CBE 44.1339% -6 - C1 -4EK4 Error CDK2_HUMAN
80 PsiBlast_CBE 37.8439% -10 - C1 -2VV9 4.7 CDK2_HUMAN
41 PsiBlast_CBE 37.4439% -12 - C1 -4EK5 3.6 CDK2_HUMAN
77 PsiBlast_CBE 37.2139% -10 - C1 -2W17 3.8 CDK2_HUMAN
35 PsiBlast_CBE 37.2039% -7 - C1 -4FKO 4.0 CDK2_HUMAN
31 PsiBlast_CBE 36.8639% -12 - C1 -4FKV 3.0 CDK2_HUMAN
33 PsiBlast_CBE 36.8039% -12 - C1 -4FKQ 4.5 CDK2_HUMAN
38 PsiBlast_CBE 36.6239% -9 - C1 -4FKG 4.3 CDK2_HUMAN
60 PsiBlast_CBE 35.8439% -9 - C1 -3IGG 3.3 CDK2_HUMAN
53 PsiBlast_CBE 35.7339% -12 - C1 -3SW7 5.1 CDK2_HUMAN
37 PsiBlast_CBE 35.4839% -11 - C1 -4FKJ 3.6 CDK2_HUMAN
32 PsiBlast_CBE 35.1539% -11 - C1 -4FKR 4.6 CDK2_HUMAN
40 PsiBlast_CBE 35.0639% -15 - C1 -4EK6 3.6 CDK2_HUMAN
30 PsiBlast_CBE 34.5139% -8 - C1 -4FKW 2.0 CDK2_HUMAN