@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CSK22_HUMAN: (2015-10-05 )
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Atome Classification :

(94 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3G5_A_3(4UBA)
CSK21_HUMAN
[Raw transfer]




CCK_X_2(3E3B)
CSK22_HUMAN
[Raw transfer]




ACP_A_7(4NH1)
CSK21_HUMAN
[Raw transfer]




ANP_A_4(1LP4)
CSK2A_MAIZE
[Raw transfer]




P04_A_2(3BE9)
CSK2A_MAIZE
[Raw transfer]




ANP_A_7(3NSZ)
CSK21_HUMAN
[Raw transfer]




ATW_A_2(3AT4)
CSK21_HUMAN
[Raw transfer]




ATK_A_2(3AT3)
CSK21_HUMAN
[Raw transfer]




GOL_C_16(4IB5)
CSK21_HUMAN
[Raw transfer]




E91_A_7(4RLK)
CSK2A_MAIZE
[Raw transfer]




GOL_A_2(4RLK)
CSK2A_MAIZE
[Raw transfer]




ACP_B_11(4NH1)
CSK21_HUMAN
[Raw transfer]




GNP_A_2(4JR7)
CSK21_YEAST
[Raw transfer]




LCT_A_2(3WIK)
CSK21_HUMAN
[Raw transfer]




01I_A_2(3MB6)
CSK21_HUMAN
[Raw transfer]




FU9_A_2(3R0T)
CSK21_HUMAN
[Raw transfer]




ANP_A_3(3U87)
CSK21_HUMAN
[Raw transfer]




LNH_A_2(3U4U)
CSK21_HUMAN
[Raw transfer]




LCD_A_2(3WIL)
CSK21_HUMAN
[Raw transfer]




3NG_A_2(3PE1)
CSK21_HUMAN
[Raw transfer]




ANP_A_4(1DAW)
CSK2A_MAIZE
[Raw transfer]




3G5_B_4(4UBA)
CSK21_HUMAN
[Raw transfer]




ANP_B_9(3U87)
CSK21_HUMAN
[Raw transfer]




E91_A_3(4RLL)
CSK21_HUMAN
[Raw transfer]




04G_B_15(3U9C)
CSK21_HUMAN
[Raw transfer]




IQA_A_2(1OM1)
CSK2A_MAIZE
[Raw transfer]




TID_A_2(3AXW)
CSK21_HUMAN
[Raw transfer]




3NG_A_3(3NGA)
CSK21_HUMAN
[Raw transfer]




ANP_B_11(3JUH)
CSK21_HUMAN
[Raw transfer]




AGI_A_7(4DGM)
CSK2A_MAIZE
[Raw transfer]




E1B_A_2(3PE2)
CSK21_HUMAN
[Raw transfer]




0XG_A_3(4GRB)
CSK21_HUMAN
[Raw transfer]




ANP_A_3(1PJK)
CSK21_HUMAN
[Raw transfer]




0Y4_A_2(4GUB)
CSK21_HUMAN
[Raw transfer]




3G5_A_2(4UB7)
CSK21_HUMAN
[Raw transfer]




CZ0_A_2(3PWD)
CSK2A_MAIZE
[Raw transfer]




3NG_B_8(3NGA)
CSK21_HUMAN
[Raw transfer]




ANP_A_14(1JWH)
CSK21_HUMAN
[Raw transfer]




18E_A_2(3OWK)
CSK21_HUMAN
[Raw transfer]




GNP_A_4(1DAY)
CSK2A_MAIZE
[Raw transfer]




HNA_A_2(1M2P)
CSK2A_MAIZE
[Raw transfer]




ANP_A_6(3JUH)
CSK21_HUMAN
[Raw transfer]




19E_A_2(3OWL)
CSK21_HUMAN
[Raw transfer]




ANP_A_4(4QNY)
?
[Raw transfer]




14I_A_2(3MB7)
CSK21_HUMAN
[Raw transfer]




GOL_B_15(4IB5)
CSK21_HUMAN
[Raw transfer]




GOL_C_17(4IB5)
CSK21_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




ANP_A_4(3WOW)
CSK21_HUMAN
[Raw transfer]




GOL_A_9(4IB5)
CSK21_HUMAN
[Raw transfer]




04G_A_6(3U9C)
CSK21_HUMAN
[Raw transfer]




WUL_A_2(4ANM)
CSK2A_MAIZE
[Raw transfer]




ANP_A_4(2PVR)
CSK21_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




EMO_B_9(3Q9X)
CSK21_HUMAN
[Raw transfer]




EMO_A_2(3Q9W)
CSK21_HUMAN
[Raw transfer]




AGI_A_2(3AMY)
CSK21_HUMAN
[Raw transfer]




4B0_A_2(3OFM)
CSK22_HUMAN
[Raw transfer]




EMO_A_4(3C13)
CSK21_HUMAN
[Raw transfer]




NIO_A_2(3WAR)
CSK21_HUMAN
[Raw transfer]




NIO_A_2(3WAR)
CSK21_HUMAN
[Raw transfer]




BEN_A_2(1LPU)
CSK2A_MAIZE
[Raw transfer]




EMO_A_4(3BQC)
CSK21_HUMAN
[Raw transfer]




BEN_A_2(1LR4)
CSK2A_MAIZE
[Raw transfer]




JRJ_A_2(5CQU)
?
[Raw transfer]




1EL_A_2(3OWJ)
CSK21_HUMAN
[Raw transfer]




BEN_A_2(1LR4)
CSK2A_MAIZE
[Raw transfer]




EMO_B_2(1F0Q)
CSK2A_MAIZE
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




0JW_A_2(4DGO)
CSK2A_MAIZE
[Raw transfer]




MNX_B_2(1M2Q)
CSK2A_MAIZE
[Raw transfer]




JRJ_A_2(4BXB)
CSK21_HUMAN
[Raw transfer]




EMO_A_3(3Q9X)
CSK21_HUMAN
[Raw transfer]




JRJ_B_14(4BXA)
CSK21_HUMAN
[Raw transfer]




JRJ_B_13(5CQW)
?
[Raw transfer]




JRJ_A_3(5CQW)
?
[Raw transfer]




K74_A_2(3KXM)
CSK2A_MAIZE
[Raw transfer]




RFZ_A_3(3H30)
CSK21_HUMAN
[Raw transfer]




K44_A_5(1ZOH)
CSK2A_MAIZE
[Raw transfer]




K25_A_3(1ZOE)
CSK2A_MAIZE
[Raw transfer]




JRJ_A_3(4BXA)
CSK21_HUMAN
[Raw transfer]




MNY_B_2(1M2R)
CSK2A_MAIZE
[Raw transfer]




TBS_A_3(1J91)
CSK2A_MAIZE
[Raw transfer]




RFZ_B_19(3H30)
CSK21_HUMAN
[Raw transfer]




EDO_A_3(3AT2)
CSK21_HUMAN
[Raw transfer]




TBS_B_4(1J91)
CSK2A_MAIZE
[Raw transfer]




K17_A_3(2OXY)
CSK2A_MAIZE
[Raw transfer]




K17_B_4(2OXY)
CSK2A_MAIZE
[Raw transfer]




4B0_A_3(3RPS)
CSK21_HUMAN
[Raw transfer]




EDO_A_6(3QA0)
CSK21_HUMAN
[Raw transfer]




K32_A_2(2OXD)
CSK2A_MAIZE
[Raw transfer]




K37_A_2(1ZOG)
CSK2A_MAIZE
[Raw transfer]




K8X_A_2(3KXN)
CSK2A_MAIZE
[Raw transfer]




EDO_A_6(1ZOH)
CSK2A_MAIZE
[Raw transfer]




PEG_A_7(3R0T)
CSK21_HUMAN
[Raw transfer]




EDO_A_5(3Q04)
CSK21_HUMAN
[Raw transfer]




DMS_A_4(1ZOE)
CSK2A_MAIZE
[Raw transfer]




1 PsiBlast_PDB 91.9699%-120 - C1 -3OFM 6.3 CSK22_HUMAN
2 PsiBlast_PDB 90.92100%-117 - C1 -3E3B 6.3 CSK22_HUMAN
46 PsiBlast_CBE 90.4585%-117 - C1 -4IB5 2.0 CSK21_HUMAN
70 PsiBlast_CBE 90.1685%-115 - C1 -3OWL 6.4 CSK21_HUMAN
42 PsiBlast_CBE 90.1685%-118 - C1 -4UB7 8.2 CSK21_HUMAN
15 PsiBlast_PDB 89.9985%-114 - C1 -3WAR 3.8 CSK21_HUMAN
71 PsiBlast_CBE 89.9085%-116 - C1 -3OWK 7.0 CSK21_HUMAN
34 PsiBlast_CBE 89.8485%-116 - C1 -3Q9X 6.7 CSK21_HUMAN
50 PsiBlast_CBE 89.8085%-120 - C1 -4BXB 6.8 CSK21_HUMAN
13 PsiBlast_PDB 89.7685%-116 - C1 -3AT4 8.8 CSK21_HUMAN
53 PsiBlast_CBE 89.6985%-116 - C1 -3U9C 5.5 CSK21_HUMAN
120 HHSearch 89.6585%-113 * C1 *3WAR 3.8 CSK21_HUMAN
11 PsiBlast_PDB 89.6585%-114 - C1 -3AT2 2.1 CSK21_HUMAN
47 PsiBlast_CBE 89.5085%-119 - C1 -4IB5 2.2 CSK21_HUMAN
30 PsiBlast_CBE 89.4285%-115 - C1 -3QA0 3.1 CSK21_HUMAN
3 PsiBlast_PDB 89.3587%-118 - C1 -3U87 5.0 CSK21_HUMAN (first)
62 PsiBlast_CBE 89.1985%-111 - C1 -3H30 4.7 CSK21_HUMAN
40 PsiBlast_CBE 89.1485%-115 - C1 -4UBA 7.6 CSK21_HUMAN
52 PsiBlast_CBE 89.1285%-115 - C1 -4BXA 7.0 CSK21_HUMAN
21 PsiBlast_CBE 89.1087%-117 - C1 -3U87 5.5 CSK21_HUMAN (first)
51 PsiBlast_CBE 88.9385%-114 - C1 -4BXA 5.8 CSK21_HUMAN
48 PsiBlast_CBE 88.8885%-113 - C1 -4IB5 3.0 CSK21_HUMAN
39 PsiBlast_CBE 88.8585%-118 - C1 -5CQU 6.9 ?
66 PsiBlast_CBE 88.8485%-115 - C1 -3NGA 8.9 CSK21_HUMAN
76 PsiBlast_CBE 88.8385%-116 - C1 -1PJK 4.5 CSK21_HUMAN
12 PsiBlast_PDB 88.7785%-113 - C1 -3AT3 9.0 CSK21_HUMAN
35 PsiBlast_CBE 88.7485%-114 - C1 -3Q9X 6.2 CSK21_HUMAN
78 PsiBlast_CBE 88.7286%-113 - C1 -3Q04 2.1 CSK21_HUMAN
75 PsiBlast_CBE 88.7285%-113 - C1 -2PVR 4.0 CSK21_HUMAN
43 PsiBlast_CBE 88.6185%-113 - C1 -4RLL 7.5 CSK21_HUMAN
27 PsiBlast_CBE 88.5785%-116 - C1 -3PE2 8.5 CSK21_HUMAN
64 PsiBlast_CBE 88.5685%-118 - C1 -4GRB 7.3 CSK21_HUMAN
38 PsiBlast_CBE 88.4585%-115 - C1 -5CQW 7.1 ?
59 PsiBlast_CBE 88.4385%-114 - C1 -3C13 6.4 CSK21_HUMAN
77 PsiBlast_CBE 88.4186%-116 - C1 -3NSZ 7.6 CSK21_HUMAN
20 PsiBlast_PDB 88.3585%-116 - C1 -3PE1 9.0 CSK21_HUMAN
54 PsiBlast_CBE 88.3385%-117 - C1 -3U9C 5.5 CSK21_HUMAN
65 PsiBlast_CBE 88.3185%-116 - C1 -3U4U 8.2 CSK21_HUMAN
22 PsiBlast_CBE 88.3184%-116 - C1 -3JUH 5.7 CSK21_HUMAN
67 PsiBlast_CBE 88.2785%-114 - C1 -3NGA 8.9 CSK21_HUMAN
72 PsiBlast_CBE 88.2585%-114 - C1 -3OWJ 6.5 CSK21_HUMAN
74 PsiBlast_CBE 88.2485%-114 - C1 -3MB6 6.4 CSK21_HUMAN
37 PsiBlast_CBE 88.2085%-115 - C1 -5CQW 5.6 ?
56 PsiBlast_CBE 88.1085%-114 - C1 -3RPS 5.9 CSK21_HUMAN
60 PsiBlast_CBE 87.9885%-113 - C1 -3BQC 6.3 CSK21_HUMAN
63 PsiBlast_CBE 87.8885%-116 - C1 -4GUB 8.7 CSK21_HUMAN
73 PsiBlast_CBE 87.7185%-115 - C1 -3MB7 6.9 CSK21_HUMAN
17 PsiBlast_PDB 87.7185%-113 - C1 -3WIK 5.8 CSK21_HUMAN
18 PsiBlast_PDB 87.6785%-115 - C1 -3WOW 4.8 CSK21_HUMAN
45 PsiBlast_CBE 87.5685%-115 - C1 -4NH1 5.5 CSK21_HUMAN
41 PsiBlast_CBE 87.5185%-111 - C1 -4UBA 7.7 CSK21_HUMAN
16 PsiBlast_PDB 87.4985%-117 - C1 -3WIL 6.6 CSK21_HUMAN
10 PsiBlast_PDB 87.2985%-120 - C1 -3AMY 6.1 CSK21_HUMAN
36 PsiBlast_CBE 87.2785%-113 - C1 -3Q9W 6.2 CSK21_HUMAN
26 PsiBlast_CBE 87.2585%-115 - C1 -3R0T 8.8 CSK21_HUMAN
61 PsiBlast_CBE 87.2485%-113 - C1 -3H30 4.8 CSK21_HUMAN
19 PsiBlast_PDB 87.0685%-118 - C1 -1JWH 3.7 CSK21_HUMAN
6 PsiBlast_PDB 87.0084%-111 - C1 -3JUH 7.0 CSK21_HUMAN
14 PsiBlast_PDB 86.9085%-115 - C1 -3AXW 5.3 CSK21_HUMAN
44 PsiBlast_CBE 86.6885%-115 - C1 -4NH1 5.2 CSK21_HUMAN
101 PsiBlast_CBE 83.5274%-119 - C1 -3KXN 5.4 CSK2A_MAIZE
90 PsiBlast_CBE 82.7574%-118 - C1 -1LR4 3.1 CSK2A_MAIZE
121 HHSearch 82.7066%-117 - C1 -4JR7 6.0 CSK21_YEAST
83 PsiBlast_CBE 82.4474%-120 - C1 -2OXY 4.5 CSK2A_MAIZE
89 PsiBlast_CBE 81.9474%-118 - C1 -1OM1 6.9 CSK2A_MAIZE
91 PsiBlast_CBE 81.5974%-117 - C1 -1LPU 3.3 CSK2A_MAIZE
107 PsiBlast_CBE 81.5574%-115 - C1 -4DGO 5.3 CSK2A_MAIZE
82 PsiBlast_CBE 81.1474%-120 - C1 -2OXY 4.3 CSK2A_MAIZE
102 PsiBlast_CBE 81.1174%-114 - C1 -3KXM 5.2 CSK2A_MAIZE
100 PsiBlast_CBE 81.0074%-115 - C1 -4DGM 6.9 CSK2A_MAIZE
88 PsiBlast_CBE 80.9974%-116 - C1 -1ZOE 5.0 CSK2A_MAIZE
80 PsiBlast_CBE 80.9974%-114 - C1 -4RLK 8.5 CSK2A_MAIZE
79 PsiBlast_CBE 80.8473%-115 - C1 -4ANM 5.6 CSK2A_MAIZE
81 PsiBlast_CBE 80.8274%-116 - C1 -3PWD 5.7 CSK2A_MAIZE
92 PsiBlast_CBE 80.6274%-115 - C1 -1LP4 6.6 CSK2A_MAIZE
108 PsiBlast_CBE 80.4474%-115 - C1 -1M2P 5.9 CSK2A_MAIZE
109 PsiBlast_CBE 80.3772%-115 - C1 -3BE9 7.8 CSK2A_MAIZE
103 PsiBlast_CBE 80.3774%-117 - C1 -1M2R 5.4 CSK2A_MAIZE
85 PsiBlast_CBE 80.3674%-114 - C1 -2OXD 4.4 CSK2A_MAIZE
104 PsiBlast_CBE 80.2074%-117 - C1 -1M2Q 5.8 CSK2A_MAIZE
86 PsiBlast_CBE 80.1174%-114 - C1 -1ZOH 6.0 CSK2A_MAIZE
94 PsiBlast_CBE 79.9374%-117 - C1 -1J91 4.4 CSK2A_MAIZE
106 PsiBlast_CBE 79.8174%-113 - C1 -1DAW 5.9 CSK2A_MAIZE
105 PsiBlast_CBE 79.5174%-115 - C1 -1DAY 6.1 CSK2A_MAIZE
95 PsiBlast_CBE 79.2474%-113 - C1 -1F0Q 5.6 CSK2A_MAIZE
93 PsiBlast_CBE 78.9374%-112 - C1 -1J91 5.7 CSK2A_MAIZE
87 PsiBlast_CBE 78.8274%-112 - C1 -1ZOG 5.9 CSK2A_MAIZE
110 Fugue 74.2768%-124 - C1 -1LR4 3.1 CSK2A_MAIZE
138 HHSearch 46.9830% -97 - C1 -2B9H 5.4 FUS3_YEAST
144 HHSearch 45.9830%-110 - C1 -4QNY 4.6 ?
141 HHSearch 45.0333% -96 - C1 -4AU8 4.9 CDK5_HUMAN
134 HHSearch 43.4432%-110 - C1 -2FST - MK14_HUMAN
136 HHSearch 40.9131% -96 - C1 -4BGQ 8.0 CDKL5_HUMAN
139 HHSearch 39.9732%-100 - C1 -1UA2 4.9 CDK7_HUMAN