@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 002_tI_WHEAT: (2014-04-29 )
IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLRGIARGIHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_3(1BWO)
NLTP1_WHEAT
[Raw transfer]




24 HHSearch 94.5396%-121 - C2 -1BWO - NLTP1_WHEAT -
1 Fugue 91.7595%-127 - C2 -1BWO 7.3 NLTP1_WHEAT
21 HHSearch 85.3453%-116 - C2 -1AFH - NLTP_MAIZE -
22 HHSearch 84.8051%-114 - C2 -1T12 - NLTP1_TOBAC -
11 SP3 83.3153%-109 - C2 -1FK5 5.1 NLTP_MAIZE
23 HHSearch 79.2944%-118 - C2 -2ALG 2.7 NLTP1_PRUPE
25 HHSearch 73.4038%-113 - C2 -1SIY - NLTP1_VIGRR -
33 HHSearch 55.0919%-123 - C2 -1BEA - ITRF_MAIZE -
35 HHSearch 53.5825% -93 - C2 -1SM7 - ? -
7 Fugue 52.4211% -91 - C2 -4DT1 - CSM2_YEAST -
16 SP3 50.9111%-117 - C2 -1HSS - IAA1_WHEAT -
2 Fugue 49.6021% -67 - C2 -2RKN - DIRL1_ARATH -
3 Fugue 48.3823% -76 - C2 -1L6H - NLTPX_ORYSJ -
32 HHSearch 46.0017%-100 - C2 -1B1U - IAAT_ELECO -
27 HHSearch 45.7921% -60 - C2 -2RKN - DIRL1_ARATH -
13 SP3 44.8422% -76 - C2 -1L6H - NLTPX_ORYSJ -
18 SP3 41.0220% -94 - C2 -1QPO - NADC_MYCTU -
36 HHSearch 39.9724% -61 - C2 -1PSY - 2SS_RICCO -
28 HHSearch 39.8529% -75 - C2 -1L6H - NLTPX_ORYSJ -
34 HHSearch 39.4622% -61 - C2 -3OB4 - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_3(1BWO)
NLTP1_WHEAT
[Raw transfer]




39 97.75100%-126 - C- -M039 - -
43 97.50100%-126 - C- -M043 - -
45 94.08100%-128 - C- -M045 - -