@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-04-29 )
AISCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPLKCGVSVPYAISSSVDCSKIR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




11 SP3 96.7470%-112 - C7 -1FK5 6.2 NLTP_MAIZE
15 HHSearch 91.5070%-122 - C7 -1AFH - NLTP_MAIZE -
20 HHSearch 89.1648%-121 - C7 -1BWO 3.5 NLTP1_WHEAT
16 HHSearch 88.6259%-117 - C7 -1T12 - NLTP1_TOBAC -
19 HHSearch 83.8143%-131 - C7 -1SIY - NLTP1_VIGRR -
18 HHSearch 83.4851%-122 - C7 -2ALG 2.4 NLTP1_PRUPE
31 HHSearch 57.9431%-106 - C7 -1PSY - 2SS_RICCO -
28 HHSearch 54.6221%-118 - C7 -1BEA - ITRF_MAIZE -
29 HHSearch 54.4821%-101 - C7 -1SM7 - ? -
3 Fugue 52.5230%-109 - C7 -1L6H - NLTPX_ORYSJ -
2 Fugue 49.3322% -76 - C7 -2RKN - DIRL1_ARATH -
25 HHSearch 48.5820%-118 - C7 -1S6D - 2SS8_HELAN -
4 Fugue 47.4716% -59 - C7 -1W2Q - CONG_ARAHY -
21 HHSearch 46.5722% -80 - C7 -2RKN - DIRL1_ARATH -
27 HHSearch 44.4816% -92 - C7 -1B1U - IAAT_ELECO -
30 HHSearch 41.6817% -89 - C7 -3OB4 - ? -
5 Fugue 40.8322% -55 - C7 -1PSY - 2SS_RICCO -
23 HHSearch 38.6129% -58 - C7 -1N89 - NLT2G_WHEAT -
22 HHSearch 37.4633% -84 - C7 -1L6H - NLTPX_ORYSJ -
12 SP3 27.9611% -58 - C5 -1EHX - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




39 99.35100%-131 - C- -M039 - -
40 95.61100%-118 - C- -M040 - -
38 93.01100%-120 - C- -M038 - -