Study : 013_tI_WHEAT (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C5_S1
Best Complexes choosen after comparative docking [pKd > 3] : 2 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C5_S1
Complex: LPC_A_4(1BWO) / Model_15(1BWO/A) = [3.5] Download1696.1139.84AVSCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR
Complex: OLA_A_2(1FK5) / Model_29(1FK5/A) = [6.1] Download1282.8839.88AVSCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR
Consensus
[pKd Mean = 4.80]
-1489
(s=206)
39
(s=0)
AVSCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR