@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-04-29 )
AISCGQVSSALAPCVAYAKGSGTSPSGACCSGVRKLAGLARSTADKQATCRCLKSVAGGLNPNKAAGIPSKCGVSVPYTISASVDCSKIH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




10 SP3 94.3464%-110 - C4 -1FK5 6.4 NLTP_MAIZE
20 HHSearch 92.7664%-110 - C4 -1AFH - NLTP_MAIZE -
25 HHSearch 91.3051%-120 - C4 -1BWO 3.9 NLTP1_WHEAT
21 HHSearch 90.6159%-122 - C4 -1T12 - NLTP1_TOBAC -
23 HHSearch 87.3455%-122 - C4 -2ALG 3.8 NLTP1_PRUPE
24 HHSearch 84.9745%-117 - C4 -1SIY - NLTP1_VIGRR -
34 HHSearch 59.1021%-110 - C4 -1SM7 - ? -
33 HHSearch 58.7021%-126 - C4 -1BEA - ITRF_MAIZE -
19 SP3 57.7418%-127 - C4 -1HSS - IAA1_WHEAT -
36 HHSearch 51.6529% -91 - C4 -1PSY - 2SS_RICCO -
3 Fugue 51.0528% -85 - C4 -1L6H - NLTPX_ORYSJ -
15 SP3 50.3213% -55 - C4 -1A0P - ? -
35 HHSearch 49.2220% -66 - C4 -3OB4 - ? -
31 HHSearch 45.9617%-115 - C4 -1S6D - 2SS8_HELAN -
11 SP3 45.8821% -67 - C4 -1L6H - NLTPX_ORYSJ -
2 Fugue 45.6827% -72 - C4 -2RKN - DIRL1_ARATH -
26 HHSearch 44.1326% -63 - C4 -2RKN - DIRL1_ARATH -
32 HHSearch 43.6915% -86 - C4 -1B1U - IAAT_ELECO -
8 Fugue 42.8611% -59 - C4 -3UUN - DMD_HUMAN -
12 SP3 42.6214%-105 - C4 -1QPO - NADC_MYCTU -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




39 95.44100%-112 - C- -M039 - -
45 95.29100%-120 - C- -M045 - -
42 41.24100% - - C- -M042 - -