Study : 044_tI_WHEAT (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 1 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: LPC_A_4(1BWO) / Model_26(1BWO/A) = [4.8] Download1245.0456.89ISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLVEANNSPDRRTICGCLENVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH
Consensus
[pKd Mean = 4.80]
-1245
(s=0)
56
(s=0)
ISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLVEANNSPDRRTICGCLENVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH