@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-04-30 )
AVANCGQVVSYLAPCISYAMGRVSVPGGGCCSGVRGLNAAAATPADRKTTCTCLKQQASGMGGIKPNLVAGIPGKCGVNIPYAISPRTDCSKVR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




20 HHSearch 93.5758%-111 - C2 -1AFH - NLTP_MAIZE -
11 SP3 93.2957%-114 - C2 -1FK5 5.8 NLTP_MAIZE
21 HHSearch 93.2853%-120 - C2 -1T12 - NLTP1_TOBAC -
24 HHSearch 88.3144%-122 - C2 -1SIY - NLTP1_VIGRR -
23 HHSearch 86.7248%-114 - C2 -2ALG 2.5 NLTP1_PRUPE
25 HHSearch 86.4544%-112 - C2 -1BWO - NLTP1_WHEAT -
9 Fugue 64.2418%-136 - C2 -1S6D - 2SS8_HELAN -
33 HHSearch 55.2319%-137 - C2 -1BEA - ITRF_MAIZE -
8 Fugue 53.8424% -82 - C2 -3U2A - ? -
35 HHSearch 51.8020%-123 - C2 -1SM7 - ? -
4 Fugue 50.5719% -63 - C2 -1PSY - 2SS_RICCO -
18 SP3 50.2220% -99 - C2 -1QPO - NADC_MYCTU -
16 SP3 49.8620% -99 - C2 -1QPO - NADC_MYCTU -
5 Fugue 48.5325% -97 - C2 -1L6H - NLTPX_ORYSJ -
2 Fugue 46.8025% -83 - C2 -2RKN - DIRL1_ARATH -
6 Fugue 46.3517% -79 - C2 -1W2Q - CONG_ARAHY -
26 HHSearch 45.2522% -90 - C2 -2RKN - DIRL1_ARATH -
34 HHSearch 45.0320% -57 - C2 -3OB4 - ? -
30 HHSearch 44.6318%-104 - C2 -1S6D - 2SS8_HELAN -
27 HHSearch 42.8324% -97 - C2 -1L6H - NLTPX_ORYSJ -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]




42 47.02100% 2 - C- -M042 - -
45 44.73100% 9 - C- -M045 - -