@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-04-30 )
AVANCGQVVSYLAPCISYAMGRVSVPGGGCCSGVRGLNAAAATPADRKTTCTCLKQQASGMGGIKPNLVAGIPGKCGVNIPYAISQGTDCSKVR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]
20 HHSearch 93.8458%-112 - C2 -1AFH - NLTP_MAIZE -
11 SP3 93.3057%-113 - C2 -1FK5 5.8 NLTP_MAIZE
21 HHSearch 90.3952%-118 - C2 -1T12 - NLTP1_TOBAC -
24 HHSearch 89.7844%-121 - C2 -1SIY - NLTP1_VIGRR -
25 HHSearch 87.0344%-112 - C2 -1BWO - NLTP1_WHEAT -
23 HHSearch 85.8948%-112 - C2 -2ALG 2.5 NLTP1_PRUPE
15 SP3 58.5521%-101 - C2 -1QPO - NADC_MYCTU -
18 SP3 58.2121%-101 - C2 -1QPO - NADC_MYCTU -
33 HHSearch 55.0019%-137 - C2 -1BEA - ITRF_MAIZE -
34 HHSearch 51.9623%-130 - C2 -1SM7 - ? -
8 Fugue 49.7719% -58 - C2 -1PSY - 2SS_RICCO -
5 Fugue 48.3825% -97 - C2 -1L6H - NLTPX_ORYSJ -
4 Fugue 46.4821% -83 - C2 -1W2Q - CONG_ARAHY -
2 Fugue 46.1425% -83 - C2 -2RKN - DIRL1_ARATH -
30 HHSearch 45.7018%-110 - C2 -1S6D - 2SS8_HELAN -
35 HHSearch 44.1020% -55 - C2 -3OB4 - ? -
26 HHSearch 43.8322% -84 - C2 -2RKN - DIRL1_ARATH -
27 HHSearch 42.9824% -97 - C2 -1L6H - NLTPX_ORYSJ -
12 SP3 42.3618% -91 - C2 -1L6H - NLTPX_ORYSJ -
36 HHSearch 41.4421% -99 - C2 -1PSY - 2SS_RICCO -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



HP6_G_7(2ALG)
NLTP1_PRUPE
[Raw transfer]
43 50.17100% -8 - C- -M043 - -
39 46.93100% 1 - C- -M039 - -
44 45.38100% 2 - C- -M044 - -
41 41.30100% 6 - C- -M041 - -