@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-04-30 )
AISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




LPC_A_3(1BWO)
NLTP1_WHEAT
[Raw transfer]




10 SP3 92.8280%-121 - C2 -1FK5 5.7 NLTP_MAIZE
19 HHSearch 88.8680%-120 - C2 -1AFH - NLTP_MAIZE -
23 HHSearch 87.0059%-122 - C2 -1BWO 6.9 NLTP1_WHEAT
18 HHSearch 81.6953%-125 - C2 -2ALG 4.0 NLTP1_PRUPE
20 HHSearch 81.2858%-119 - C2 -1T12 - NLTP1_TOBAC -
22 HHSearch 75.6844%-117 - C2 -1SIY - NLTP1_VIGRR -
30 HHSearch 56.0619%-148 - C2 -1BEA - ITRF_MAIZE -
32 HHSearch 52.3125%-122 - C2 -1SM7 - ? -
33 HHSearch 48.3930% -89 - C2 -1PSY - 2SS_RICCO -
3 Fugue 45.3528%-102 - C2 -1L6H - NLTPX_ORYSJ -
4 Fugue 43.8624% -48 - C2 -1PSY - 2SS_RICCO -
6 Fugue 43.7817% -77 - C2 -1S6D - 2SS8_HELAN -
25 HHSearch 42.9936% -87 - C2 -1L6H - NLTPX_ORYSJ -
2 Fugue 42.9721% -93 - C2 -2RKN - DIRL1_ARATH -
31 HHSearch 42.9620% -77 - C2 -3OB4 - ? -
29 HHSearch 42.1314%-106 - C2 -1B1U - IAAT_ELECO -
24 HHSearch 38.6323% -83 - C2 -2RKN - DIRL1_ARATH -
11 SP3 30.1411% -77 * C3 *1EHX - ? -
26 HHSearch 28.6327% -46 - C2 -1N89 - NLT2G_WHEAT -
9 Fugue 26.6514% -50 - C2 -4HLB - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




LPC_A_4(1BWO)
NLTP1_WHEAT
[Raw transfer]




LPC_A_3(1BWO)
NLTP1_WHEAT
[Raw transfer]




42 93.96100%-133 - C- -M042 - -
41 91.00100%-125 - C- -M041 - -
39 90.77100%-122 - C- -M039 - -