@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-01 )
LMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
22 HHSearch 89.2857%-118 - C3 -1T12 - NLTP1_TOBAC -
24 HHSearch 88.5353%-119 - C3 -1SIY - NLTP1_VIGRR -
21 HHSearch 83.3853%-126 - C3 -2ALG 3.6 NLTP1_PRUPE
11 SP3 80.4948%-119 - C3 -1FK5 5.6 NLTP_MAIZE
23 HHSearch 77.5949%-112 - C3 -1AFH - NLTP_MAIZE -
26 HHSearch 76.2839%-122 - C3 -1BWO - NLTP1_WHEAT -
36 HHSearch 62.3731%-133 - C3 -1SM7 - ? -
34 HHSearch 58.2823%-156 - C3 -1BEA - ITRF_MAIZE -
38 HHSearch 57.7021%-159 * C3 *1HSS - IAA1_WHEAT -
18 SP3 51.9218%-122 - C3 -1HSS - IAA1_WHEAT -
39 HHSearch 51.3319%-107 - C3 -2LVF - ? -
27 HHSearch 48.6121%-106 - C3 -2RKN - DIRL1_ARATH -
32 HHSearch 47.6618%-139 - C3 -1B1U - IAAT_ELECO -
33 HHSearch 47.1927% -69 - C3 -1PSY - 2SS_RICCO -
2 Fugue 45.9922% -82 - C3 -2RKN - DIRL1_ARATH -
16 SP3 44.089% -81 - C3 -1O4U - ? -
13 SP3 43.1018% -92 - C3 -1QPO - NADC_MYCTU -
35 HHSearch 41.3922% -84 - C3 -3OB4 - ? -
14 SP3 41.2317% -90 - C3 -1QPO - NADC_MYCTU -
5 Fugue 39.3228% -70 - C3 -1L6H - NLTPX_ORYSJ -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
47 94.09100%-128 - C- -M047 - -
45 92.37100%-124 - C- -M045 - -
41 34.45100% 18 - C- -M041 - -