@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-01 )
AISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
20 HHSearch 95.8957%-121 - C2 -2ALG 3.9 NLTP1_PRUPE
24 HHSearch 94.7854%-131 - C2 -1SIY - NLTP1_VIGRR -
21 HHSearch 91.0153%-124 - C2 -1T12 - NLTP1_TOBAC -
11 SP3 89.4450%-118 - C2 -1FK5 5.2 NLTP_MAIZE
22 HHSearch 88.2150%-113 - C2 -1AFH - NLTP_MAIZE -
25 HHSearch 87.2740%-129 - C2 -1BWO - NLTP1_WHEAT -
35 HHSearch 61.9024%-132 - C2 -1SM7 - ? -
32 HHSearch 57.1617%-121 - C2 -1BEA - ITRF_MAIZE -
26 HHSearch 55.7930% -99 - C2 -2RKN - DIRL1_ARATH -
14 SP3 55.5417%-117 - C2 -1HSS - IAA1_WHEAT -
2 Fugue 54.0029% -74 - C2 -2RKN - DIRL1_ARATH -
33 HHSearch 53.9326% -78 - C2 -1PSY - 2SS_RICCO -
9 Fugue 53.2123% -70 - C2 -1PSY - 2SS_RICCO -
18 SP3 49.5315% -99 - C2 -1QPO - NADC_MYCTU -
28 HHSearch 49.1126% -92 - C2 -1N89 - NLT2G_WHEAT -
31 HHSearch 48.8917%-110 - C2 -1B1U - IAAT_ELECO -
3 Fugue 47.9926% -79 - C2 -1L6H - NLTPX_ORYSJ -
13 SP3 46.8119% -83 - C2 -1L6H - NLTPX_ORYSJ -
27 HHSearch 44.5725% -71 - C2 -1L6H - NLTPX_ORYSJ -
4 Fugue 44.4118% -77 - C2 -1HSS - IAA1_WHEAT -


User Run . : Multi Template Modeling Result:

(5 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
38 99.83100%-135 - C- -M038 - -
37 99.28100%-128 - C- -M037 - -
44 97.42100%-141 - C- -M044 - -
43 97.06100%-134 - C- -M043 - -
40 95.74100%-138 - C- -M040 - -