@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 086_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 95.4697%-126 - C5 -1N89 6.1 NLT2G_WHEAT
2 HHSearch 76.8060%-138 - C5 -1L6H - NLTPX_ORYSJ -
26 SP3 76.5459%-137 - C5 -1L6H - NLTPX_ORYSJ -
16 Fugue 76.5459%-137 - C5 -1L6H - NLTPX_ORYSJ -
34 SP3 69.5422%-153 - C5 -1S6D - 2SS8_HELAN -
17 Fugue 67.6931%-120 - C5 -2RKN - DIRL1_ARATH -
3 HHSearch 60.1330%-110 - C5 -2RKN - DIRL1_ARATH -
8 HHSearch 57.7228% -84 - C5 -1AFH - NLTP_MAIZE -
9 HHSearch 56.7335% -98 - C5 -1T12 - NLTP1_TOBAC -
18 Fugue 56.6230% -83 - C5 -1BWO - NLTP1_WHEAT -
27 SP3 54.4325% -88 - C5 -1FK5 - NLTP_MAIZE -
7 HHSearch 51.3928% -83 - C5 -2ALG - NLTP1_PRUPE -
5 HHSearch 49.2723% -71 - C5 -1SIY - NLTP1_VIGRR -
4 HHSearch 49.0828% -55 - C5 -1BWO - NLTP1_WHEAT -
11 HHSearch 48.3823%-101 - C5 -1HYP - HPSE_SOYBN -
29 SP3 46.7016% -91 - C3 -1U78 - TC3A_CAEEL -
21 Fugue 46.5914%-104 * C3 *1DIK - ? -
20 Fugue 45.1527% -78 - C1 -1CWV - -
25 Fugue 44.8918% -81 - C5 -1Q1V - DEK_HUMAN -
19 Fugue 43.2621%-108 * C7 *2KSS - CARS_MYXXA -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 90.56100%-119 - C- -M040 - -
43 90.25100%-118 - C- -M043 - -
42 88.52100%-122 - C- -M042 - -