@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 087_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQPCFCQYAKDPTYGQYIRSPHARDTLQSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 94.9197%-123 - C2 -1N89 6.1 NLT2G_WHEAT
2 HHSearch 77.4358%-134 - C2 -1L6H - NLTPX_ORYSJ -
26 SP3 77.3958%-134 - C2 -1L6H - NLTPX_ORYSJ -
16 Fugue 77.3958%-134 - C2 -1L6H - NLTPX_ORYSJ -
17 Fugue 67.0131%-118 - C2 -2RKN - DIRL1_ARATH -
34 SP3 66.5822%-152 - C2 -1S6D - 2SS8_HELAN -
3 HHSearch 61.0030%-108 - C2 -2RKN - DIRL1_ARATH -
27 SP3 60.7225% -78 * C2 *1FK5 - NLTP_MAIZE -
9 HHSearch 60.1735%-102 - C2 -1T12 - NLTP1_TOBAC -
8 HHSearch 59.0828% -86 - C2 -1AFH - NLTP_MAIZE -
18 Fugue 56.5830% -79 - C2 -1BWO - NLTP1_WHEAT -
7 HHSearch 56.4128% -84 - C2 -2ALG - NLTP1_PRUPE -
4 HHSearch 51.2428% -51 - C2 -1BWO - NLTP1_WHEAT -
10 HHSearch 49.9323% -96 - C2 -1HYP - HPSE_SOYBN -
28 SP3 49.6516% -87 - C2 -1U78 - TC3A_CAEEL -
5 HHSearch 48.1223% -72 - C2 -1SIY - NLTP1_VIGRR -
30 SP3 46.9517% -76 - C2 -1F9M - TRXF_SPIOL -
22 Fugue 46.1220% -78 - C2 -1Q1V - DEK_HUMAN -
21 Fugue 45.7626% -78 * C4 *1CWV - -
29 SP3 45.2417% -88 - C2 -1KNG - CYCY_BRADU -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
43 95.46100%-126 - C- -M043 - -
40 93.96100%-118 - C- -M040 - -
41 92.71100%-128 - C- -M041 - -
42 92.39100%-122 - C- -M042 - -