@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 088_tII_WHEAT: (2014-05-01 )
ACRASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 96.2699%-125 - C4 -1N89 5.9 NLT2G_WHEAT
2 HHSearch 80.2460%-145 - C4 -1L6H - NLTPX_ORYSJ -
26 SP3 79.3759%-145 * C4 *1L6H - NLTPX_ORYSJ -
16 Fugue 79.3759%-145 - C4 -1L6H - NLTPX_ORYSJ -
17 Fugue 68.3631%-115 - C4 -2RKN - DIRL1_ARATH -
3 HHSearch 62.3130%-109 - C4 -2RKN - DIRL1_ARATH -
8 HHSearch 61.4928% -88 - C4 -1AFH - NLTP_MAIZE -
27 SP3 61.3425% -84 - C4 -1FK5 - NLTP_MAIZE -
9 HHSearch 61.0235%-103 - C4 -1T12 - NLTP1_TOBAC -
18 Fugue 58.9430% -83 - C4 -1BWO - NLTP1_WHEAT -
7 HHSearch 55.0528% -86 - C4 -2ALG - NLTP1_PRUPE -
11 HHSearch 52.1423%-101 - C4 -1HYP - HPSE_SOYBN -
4 HHSearch 52.0328% -54 - C4 -1BWO - NLTP1_WHEAT -
5 HHSearch 52.0023% -75 - C4 -1SIY - NLTP1_VIGRR -
22 Fugue 48.5419%-109 * C6 *2KSS - CARS_MYXXA -
19 Fugue 48.1927% -82 - C1 -1CWV - -
35 SP3 45.8314%-109 - C4 -1TC3 - TC3A_CAEEL -
24 Fugue 44.7913% -93 - C6 -1GCQ - -
28 SP3 44.3413% -76 - C4 -1U78 - TC3A_CAEEL -
34 SP3 42.2913% -88 - C4 -1XFL - TRXH1_ARATH -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
42 92.82100%-123 - C- -M042 - -
43 92.56100%-118 - C- -M043 - -
40 92.50100%-120 - C- -M040 - -
41 88.70100%-108 - C- -M041 - -