@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 089_tII_WHEAT: (2014-05-01 )
CEVTQLAVCASAILGGTKPSGECCGNLRAQQGCFCQYVKDPNYGHYVNSPHARETLQTCGIALPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




1 HHSearch 98.3477%-127 - C5 -1N89 6.2 NLT2G_WHEAT
26 SP3 83.2562%-128 - C5 -1L6H - NLTPX_ORYSJ -
16 Fugue 83.2562%-128 - C5 -1L6H - NLTPX_ORYSJ -
2 HHSearch 83.2462%-128 - C5 -1L6H - NLTPX_ORYSJ -
17 Fugue 73.0933%-121 - C5 -2RKN - DIRL1_ARATH -
3 HHSearch 69.0430%-110 - C5 -2RKN - DIRL1_ARATH -
8 HHSearch 67.6129% -90 - C5 -1AFH - NLTP_MAIZE -
27 SP3 65.7024% -82 * C5 *1FK5 - NLTP_MAIZE -
9 HHSearch 64.7735%-100 - C5 -1T12 - NLTP1_TOBAC -
7 HHSearch 61.4831% -86 - C5 -2ALG - NLTP1_PRUPE -
20 Fugue 61.2829% -75 - C5 -1BWO - NLTP1_WHEAT -
28 SP3 61.0116%-109 - C5 -1KNG - CYCY_BRADU -
11 HHSearch 58.4725%-110 - C5 -1HYP - HPSE_SOYBN -
4 HHSearch 54.6731% -47 - C5 -1BWO - NLTP1_WHEAT -
5 HHSearch 51.6121% -71 - C5 -1SIY - NLTP1_VIGRR -
23 Fugue 50.8013% -89 - C5 -1S6D - 2SS8_HELAN -
31 SP3 50.2013% -96 - C5 -1ELK - TOM1_HUMAN -
32 SP3 48.6615% -98 - C4 -1U78 - TC3A_CAEEL -
18 Fugue 48.0624% -64 - C5 -1QSD - TBCA_YEAST -
21 Fugue 44.8226% -96 - C1 -4DTH - ? -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




40 96.67100%-133 - C- -M040 - -
41 96.57100%-138 - C- -M041 - -
42 96.02100%-131 - C- -M042 - -
43 95.12100%-134 - C- -M043 - -