Study : 090_tII_WHEAT (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 1 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: PGM_B_2(1N89) / Model_11(1N89/A) = [6.2] Download1210.5156.62ECQVTQLAVCASAILGGTKPSGECCGNLRAQQGCFCQYVKDPNYGHYVNSPHARETLQTCGIALPHC
Consensus
[pKd Mean = 6.20]
-1210
(s=0)
56
(s=0)
ECQVTQLAVCASAILGGTKPSGECCGNLRAQQGCFCQYVKDPNYGHYVNSPHARETLQTCGIALPHC