@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 091_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLQSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 94.9499%-123 - C4 -1N89 6.1 NLT2G_WHEAT
26 SP3 78.1259%-133 - C4 -1L6H - NLTPX_ORYSJ -
16 Fugue 78.1259%-133 - C4 -1L6H - NLTPX_ORYSJ -
2 HHSearch 78.0460%-134 - C4 -1L6H - NLTPX_ORYSJ -
17 Fugue 70.1631%-120 - C4 -2RKN - DIRL1_ARATH -
35 SP3 66.0822%-151 - C4 -1S6D - 2SS8_HELAN -
3 HHSearch 63.1830%-110 - C4 -2RKN - DIRL1_ARATH -
8 HHSearch 61.9628% -88 - C4 -1AFH - NLTP_MAIZE -
9 HHSearch 61.6535%-103 - C4 -1T12 - NLTP1_TOBAC -
27 SP3 57.8725% -86 - C4 -1FK5 - NLTP_MAIZE -
18 Fugue 57.6930% -82 - C4 -1BWO - NLTP1_WHEAT -
7 HHSearch 57.1628% -86 - C4 -2ALG - NLTP1_PRUPE -
5 HHSearch 53.0123% -75 - C4 -1SIY - NLTP1_VIGRR -
11 HHSearch 51.2823% -98 - C4 -1HYP - HPSE_SOYBN -
4 HHSearch 50.4228% -53 - C4 -1BWO - NLTP1_WHEAT -
30 SP3 46.0114% -77 - C4 -1F9M - TRXF_SPIOL -
23 Fugue 45.6220% -78 - C4 -1Q1V - DEK_HUMAN -
19 Fugue 45.0427% -76 * C2 *1CWV - -
21 Fugue 44.7421%-104 * C6 *2KSS - CARS_MYXXA -
22 Fugue 43.9614% -97 - C1 -1DIK - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 92.63100%-118 - C- -M040 - -
43 91.04100%-127 - C- -M043 - -
42 90.21100%-115 - C- -M042 - -