@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 092_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQPCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




1 HHSearch 94.7599%-123 - C2 -1N89 5.9 NLT2G_WHEAT
2 HHSearch 77.7558%-139 - C2 -1L6H - NLTPX_ORYSJ -
28 SP3 77.3958%-139 - C2 -1L6H - NLTPX_ORYSJ -
18 Fugue 77.3958%-139 - C2 -1L6H - NLTPX_ORYSJ -
19 Fugue 67.0431%-118 - C2 -2RKN - DIRL1_ARATH -
37 SP3 66.0122%-156 - C2 -1S6D - 2SS8_HELAN -
29 SP3 60.0825% -83 - C2 -1FK5 - NLTP_MAIZE -
3 HHSearch 59.9430%-108 - C2 -2RKN - DIRL1_ARATH -
9 HHSearch 59.0035%-101 - C2 -1T12 - NLTP1_TOBAC -
8 HHSearch 57.9328% -86 - C2 -1AFH - NLTP_MAIZE -
20 Fugue 57.2130% -79 - C2 -1BWO - NLTP1_WHEAT -
7 HHSearch 51.9428% -84 - C2 -2ALG - NLTP1_PRUPE -
10 HHSearch 50.7723% -98 - C2 -1HYP - HPSE_SOYBN -
4 HHSearch 50.6628% -52 - C2 -1BWO - NLTP1_WHEAT -
22 Fugue 49.2127% -83 * C3 *1CWV - -
5 HHSearch 47.0623% -72 - C2 -1SIY - NLTP1_VIGRR -
30 SP3 43.4513% -74 - C2 -1U78 - TC3A_CAEEL -
24 Fugue 42.0220% -79 - C2 -1Q1V - DEK_HUMAN -
35 SP3 40.4919% -53 * C2 *1HYP - ? -
32 SP3 39.9016% -76 - C2 -1F9M - TRXF_SPIOL -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




45 94.37100%-121 - C- -M045 - -
42 93.75100%-127 - C- -M042 - -
43 93.41100%-138 - C- -M043 - -
44 91.77100%-124 - C- -M044 - -