Study : 100_tII_WHEAT (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 1 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: PGM_B_2(1N89) / Model_1(1N89/A) = [5.8] Download1139.7255.92ATCNALQLTPCAGAIVGNAAPTASCCSKMKEQQPCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC
Consensus
[pKd Mean = 5.80]
-1139
(s=0)
55
(s=0)
ATCNALQLTPCAGAIVGNAAPTASCCSKMKEQQPCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC