@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 101_tII_WHEAT: (2014-05-01 )
ATCNALQLTPCAGAIIGSAAPTASCCSKMKEQQPCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




2 HHSearch 93.2653%-108 - C5 -1L6H - NLTPX_ORYSJ -
25 SP3 92.8652%-108 - C5 -1L6H - NLTPX_ORYSJ -
16 Fugue 92.8652%-108 - C5 -1L6H - NLTPX_ORYSJ -
1 HHSearch 88.0043%-101 - C5 -1N89 5.5 NLT2G_WHEAT
17 Fugue 76.7223% -79 - C5 -2RKN - DIRL1_ARATH -
3 HHSearch 69.0223% -82 - C5 -2RKN - DIRL1_ARATH -
26 SP3 67.2125% -61 - C5 -1FK5 - NLTP_MAIZE -
4 HHSearch 64.7323% -53 - C5 -1BWO - NLTP1_WHEAT -
8 HHSearch 61.8624% -86 - C5 -1AFH - NLTP_MAIZE -
34 SP3 61.7020%-117 - C5 -1S6D - 2SS8_HELAN -
9 HHSearch 59.8423% -59 - C5 -1T12 - NLTP1_TOBAC -
10 HHSearch 58.3120% -95 - C5 -1HYP - HPSE_SOYBN -
5 HHSearch 57.9623% -56 - C5 -1SIY - NLTP1_VIGRR -
6 HHSearch 57.8327% -79 - C5 -2ALG - NLTP1_PRUPE -
20 Fugue 57.6811%-105 - C5 -3ZR8 - ? -
29 SP3 49.3013% -60 - C5 -1PS6 - PDXA_ECOLI -
28 SP3 48.2313% -57 - C5 -1KNG - CYCY_BRADU -
27 SP3 47.7610% -71 - C5 -1U78 - TC3A_CAEEL -
19 Fugue 43.7418% -42 - C5 -2LSE - ? -
33 SP3 43.6110% -74 * C5 *1TC3 - TC3A_CAEEL -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




40 97.74100%-105 - C- -M040 - -
39 90.53100% -91 - C- -M039 - -