@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 108_tII_WHEAT: (2014-05-01 )
QCNAGSLAVCASPIISGAKPSTTCCNNLKSQRGCFCQYARNPAYSSYINSPNARKTLTSCGVAVPKC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 96.4567%-108 - C6 -1N89 6.6 NLT2G_WHEAT
2 HHSearch 81.7055%-116 - C6 -1L6H - NLTPX_ORYSJ -
27 SP3 81.3555%-116 - C6 -1L6H - NLTPX_ORYSJ -
17 Fugue 81.3555%-116 - C6 -1L6H - NLTPX_ORYSJ -
5 HHSearch 65.0233% -80 - C6 -1SIY - NLTP1_VIGRR -
18 Fugue 63.9826% -87 - C6 -2RKN - DIRL1_ARATH -
8 HHSearch 62.8333% -84 - C6 -1AFH - NLTP_MAIZE -
3 HHSearch 62.1327% -97 - C6 -2RKN - DIRL1_ARATH -
28 SP3 61.9831% -68 * C6 *1FK5 - NLTP_MAIZE -
9 HHSearch 60.4732% -92 - C6 -1T12 - NLTP1_TOBAC -
11 HHSearch 56.2525% -97 - C6 -1HYP - HPSE_SOYBN -
7 HHSearch 54.8633% -76 - C6 -2ALG - NLTP1_PRUPE -
29 SP3 51.1713% -92 - C6 -1KNG - CYCY_BRADU -
4 HHSearch 49.0431% -49 - C6 -1BWO - NLTP1_WHEAT -
24 Fugue 45.8219% -55 - C1 -2KSS - CARS_MYXXA -
30 SP3 43.2810% -73 - C6 -1U78 - TC3A_CAEEL -
21 Fugue 41.8720% -87 - C3 -1MOL - MONB_DIOCU -
34 SP3 40.8411% -87 - C6 -1TC3 - TC3A_CAEEL -
32 SP3 40.3213% -69 - C6 -1PS6 - PDXA_ECOLI -
33 SP3 39.4113% -63 - C6 -1ELK - TOM1_HUMAN -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
44 92.95100%-121 - C- -M044 - -
42 90.28100%-109 - C- -M042 - -
41 86.91100%-108 - C- -M041 - -