@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 109_tII_WHEAT: (2014-05-01 )
QCNAGSLAVCTSPIISGTPPSKTCCNNLKSQRGCFCKFARNPAYSSYINSRNAGKTLTSCGIAVPKC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 95.5357%-107 - C1 -1N89 5.9 NLT2G_WHEAT
2 HHSearch 88.6054%-114 - C1 -1L6H - NLTPX_ORYSJ -
26 SP3 87.9353%-114 - C1 -1L6H - NLTPX_ORYSJ -
16 Fugue 87.9353%-114 - C1 -1L6H - NLTPX_ORYSJ -
17 Fugue 76.9426% -90 - C1 -2RKN - DIRL1_ARATH -
3 HHSearch 73.7425% -98 - C1 -2RKN - DIRL1_ARATH -
5 HHSearch 71.7231% -75 - C1 -1SIY - NLTP1_VIGRR -
27 SP3 65.7529% -69 - C1 -1FK5 - NLTP_MAIZE -
9 HHSearch 64.6830% -83 - C1 -1T12 - NLTP1_TOBAC -
8 HHSearch 64.2931% -83 - C1 -1AFH - NLTP_MAIZE -
7 HHSearch 63.1231% -78 - C1 -2ALG - NLTP1_PRUPE -
23 Fugue 58.5516% -90 - C1 -1S6D - 2SS8_HELAN -
11 HHSearch 58.3027% -91 - C1 -1HYP - HPSE_SOYBN -
4 HHSearch 52.0528% -56 - C1 -1BWO - NLTP1_WHEAT -
20 Fugue 51.8211% -90 - C1 -1VD2 - KPCI_HUMAN -
29 SP3 48.688% -80 - C1 -1U78 - TC3A_CAEEL -
28 SP3 44.1410%-101 - C1 -1KNG - CYCY_BRADU -
18 Fugue 43.9418% -39 - C1 -2RP4 - ? -
33 SP3 43.3719% -79 - C1 -3FRU - FCGRN_RAT -
21 Fugue 41.969% -68 - C1 -3NNF - ? -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 94.24100%-130 - C- -M040 - -
42 91.84100%-115 - C- -M042 - -