@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 111_tII_WHEAT: (2014-05-01 )
QDCDAGKLIVCAAAIIGGAEPSASCCTNLKAQRGCLCKYASNPAYSGYINSPTTRKTLASCGIPIPTCPQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




12 HHSearch 93.2254%-118 - C2 -1L6H - NLTPX_ORYSJ -
1 Fugue 92.8253%-118 - C2 -1L6H - NLTPX_ORYSJ -
26 SP3 92.4252%-118 * C2 *1L6H - NLTPX_ORYSJ -
11 HHSearch 88.6255%-110 - C2 -1N89 4.7 NLT2G_WHEAT
33 SP3 72.9420%-145 - C2 -1S6D - 2SS8_HELAN -
2 Fugue 72.1729%-103 - C2 -2RKN - DIRL1_ARATH -
13 HHSearch 67.4228%-110 - C2 -2RKN - DIRL1_ARATH -
15 HHSearch 66.4631% -96 - C2 -1SIY - NLTP1_VIGRR -
19 HHSearch 65.5032%-115 - C2 -1T12 - NLTP1_TOBAC -
5 Fugue 62.9617%-109 - C2 -1S6D - 2SS8_HELAN -
17 HHSearch 62.4824% -90 - C2 -2ALG - NLTP1_PRUPE -
21 HHSearch 61.7825%-125 - C2 -1HYP - HPSE_SOYBN -
27 SP3 61.6925% -80 - C2 -1FK5 - NLTP_MAIZE -
18 HHSearch 60.4829% -94 - C2 -1AFH - NLTP_MAIZE -
14 HHSearch 52.0426% -60 - C2 -1BWO - NLTP1_WHEAT -
10 Fugue 49.9525% -94 - C2 -1MOL - MONB_DIOCU -
30 SP3 48.7022% -65 - C2 -1HYP - ? -
31 SP3 43.5014% -89 - C2 -1LU4 - -
32 SP3 43.4912% -81 - C2 -1ELK - TOM1_HUMAN -
28 SP3 42.7310% -83 - C2 -1U78 - TC3A_CAEEL -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]




40 91.48100%-118 - C- -M040 - -
41 90.87100%-122 - C- -M041 - -