@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 120_tII_ORYSA: (2014-05-01 )
QAPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPLPNCG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
10 HHSearch 91.0157%-137 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 90.6456%-137 - C4 -1L6H - NLTPX_ORYSJ -
24 SP3 89.1652%-137 - C4 -1L6H - NLTPX_ORYSJ -
11 HHSearch 87.9752%-140 - C4 -1N89 5.2 NLT2G_WHEAT
2 Fugue 71.6627%-129 - C4 -2RKN - DIRL1_ARATH -
15 HHSearch 69.6332%-101 - C4 -2ALG - NLTP1_PRUPE -
12 HHSearch 69.2025%-117 - C4 -2RKN - DIRL1_ARATH -
18 HHSearch 68.3432%-109 - C4 -1T12 - NLTP1_TOBAC -
25 SP3 65.8524%-109 * C4 *1FK5 - NLTP_MAIZE -
17 HHSearch 65.3830%-115 - C4 -1AFH - NLTP_MAIZE -
16 HHSearch 64.0230%-113 - C4 -1SIY - NLTP1_VIGRR -
13 HHSearch 62.8833% -96 - C4 -1BWO - NLTP1_WHEAT -
26 SP3 61.4320%-109 - C4 -1KNG - CYCY_BRADU -
5 Fugue 59.2327%-101 - C4 -1BWO - NLTP1_WHEAT -
20 HHSearch 58.9625%-131 - C4 -1HYP - HPSE_SOYBN -
7 Fugue 53.1111%-110 - C4 -3EPH - MOD5_YEAST -
28 SP3 50.8113%-112 - C4 -1U78 - TC3A_CAEEL -
3 Fugue 50.5214% -82 - C4 -1S6D - 2SS8_HELAN -
27 SP3 48.9114%-106 - C4 -1PS6 - PDXA_ECOLI -
32 SP3 47.988%-131 - C4 -1WLJ - ISG20_HUMAN -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
38 54.25100% -51 - C- -M038 - -
40 38.20100% -25 - C- -M040 - -