@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 122_tII_ORYSA: (2014-05-01 )
QAPPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPFPNCS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
11 HHSearch 95.1152%-142 - C4 -1N89 5.4 NLT2G_WHEAT
12 HHSearch 92.5355%-141 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 92.5355%-141 - C4 -1L6H - NLTPX_ORYSJ -
24 SP3 90.5550%-141 - C4 -1L6H - NLTPX_ORYSJ -
2 Fugue 75.3227%-129 - C4 -2RKN - DIRL1_ARATH -
13 HHSearch 71.7025%-116 - C4 -2RKN - DIRL1_ARATH -
19 HHSearch 71.0632%-112 - C4 -1T12 - NLTP1_TOBAC -
15 HHSearch 70.6332%-103 - C4 -2ALG - NLTP1_PRUPE -
25 SP3 67.1925%-109 * C4 *1FK5 - NLTP_MAIZE -
18 HHSearch 66.2030%-115 - C4 -1AFH - NLTP_MAIZE -
17 HHSearch 65.8730%-113 - C4 -1SIY - NLTP1_VIGRR -
7 Fugue 63.2129%-105 - C4 -1BWO - NLTP1_WHEAT -
14 HHSearch 62.6431% -97 - C4 -1BWO - NLTP1_WHEAT -
21 HHSearch 61.5125%-133 - C4 -1HYP - HPSE_SOYBN -
28 SP3 59.4922%-106 - C4 -1KNG - CYCY_BRADU -
4 Fugue 52.1014% -76 - C4 -1S6D - 2SS8_HELAN -
27 SP3 50.3712%-102 - C4 -1U78 - TC3A_CAEEL -
33 SP3 46.5714% -86 - C4 -1KFS - -
26 SP3 44.4714%-105 - C4 -1PS6 - PDXA_ECOLI -
29 SP3 41.7212% -78 - C4 -1F9M - TRXF_SPIOL -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 55.84100% -46 - C- -M040 - -
41 55.31100% -45 - C- -M041 - -