@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 124_tII_ORYSA: (2014-05-01 )
QCDPEQLSACVSPIFYGTAPSESCCSNLRAQQKEGCLCQYAKDPTYASYVNNTNARKTIAACGIPIPSC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
11 HHSearch 89.9854%-110 - C4 -1N89 4.2 NLT2G_WHEAT
25 SP3 89.5652%-120 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 89.4552%-118 - C4 -1L6H - NLTPX_ORYSJ -
12 HHSearch 89.2254%-120 - C4 -1L6H - NLTPX_ORYSJ -
2 Fugue 80.2029% -83 - C4 -2RKN - DIRL1_ARATH -
26 SP3 72.2428% -81 - C4 -1FK5 - NLTP_MAIZE -
13 HHSearch 70.7228% -96 - C4 -2RKN - DIRL1_ARATH -
17 HHSearch 68.5336% -74 - C4 -2ALG - NLTP1_PRUPE -
18 HHSearch 67.2933% -89 - C4 -1AFH - NLTP_MAIZE -
15 HHSearch 65.7126% -81 - C4 -1SIY - NLTP1_VIGRR -
30 SP3 64.2821%-108 * C4 *1HYP - ? -
14 HHSearch 62.0428% -63 - C4 -1BWO - NLTP1_WHEAT -
19 HHSearch 61.6128% -82 - C4 -1T12 - NLTP1_TOBAC -
27 SP3 60.5621% -84 - C4 -1QNT - MGMT_HUMAN -
21 HHSearch 60.4326% -95 - C4 -1HYP - HPSE_SOYBN -
4 Fugue 59.1517% -80 - C4 -1S6D - 2SS8_HELAN -
28 SP3 51.3513% -84 - C4 -1XPJ - ? -
31 SP3 49.5411% -92 - C3 -1KZF - ESAI_ERWST -
32 SP3 47.718% -51 - C4 -1HQV - PDCD6_MOUSE -
34 SP3 46.5013% -90 - C4 -1A0F - GSTA_ECOLI -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
41 97.57100%-114 - C- -M041 - -
42 95.46100%-107 - C- -M042 - -
37 45.68100% -13 - C- -M037 - -