@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 149_tIV_ORYSA: (2014-05-02 )
VCNMSNDEFMKCQPAAAATSNPTTNPSAGCCSALSHADLNCLCSYKNSPWLSIYNIDPNRAMQLPAKCGLTMPANC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 94.7650%-101 - C3 -2RKN 6.1 DIRL1_ARATH
11 HHSearch 94.2151% -98 - C3 -2RKN - DIRL1_ARATH -
35 SP3 75.8222%-108 - C3 -1HSS - IAA1_WHEAT -
15 HHSearch 66.7429% -66 - C3 -1SIY - NLTP1_VIGRR -
19 HHSearch 65.6926% -83 - C3 -2ALG - NLTP1_PRUPE -
18 HHSearch 65.3625% -78 - C3 -1T12 - NLTP1_TOBAC -
32 SP3 64.2725% -73 - C3 -1FK5 - NLTP_MAIZE -
34 SP3 62.9619%-109 - C3 -1HYP - ? -
14 HHSearch 59.8630% -57 - C3 -1AFH - NLTP_MAIZE -
12 HHSearch 59.4729% -73 - C3 -1N89 - NLT2G_WHEAT -
26 HHSearch 58.8621% -60 * C3 *1HSS - IAA1_WHEAT -
2 Fugue 58.7526% -82 - C3 -1L6H - NLTPX_ORYSJ -
33 SP3 58.4425% -98 - C3 -1L6H - NLTPX_ORYSJ -
27 HHSearch 58.3019% -60 - C3 -1BEA - ITRF_MAIZE -
17 HHSearch 58.0222% -48 - C3 -1BWO - NLTP1_WHEAT -
13 HHSearch 57.3929% -88 - C3 -1L6H - NLTPX_ORYSJ -
5 Fugue 56.7822% -72 - C3 -1S6D - 2SS8_HELAN -
4 Fugue 54.7216% -89 - C3 -1IGN - RAP1_YEAST -
38 SP3 52.6715% -82 - C3 -1A32 - ? -
39 SP3 52.3510% -76 - C2 -1XOC - APPA_BACSU -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
49 96.19100%-122 - C- -M049 - -
45 93.12100%-111 - C- -M045 - -
42 91.63100%-106 - C- -M042 - -
48 85.81100%-109 - C- -M048 - -