@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 152_tIV_ARATH: (2014-05-02 )
IDLCGMTQAELNECLPAVSKNNPTSPSLLCCNALKHADYTCLCGYKNSPWLGSFGVDPKLASSLPKECDLTNAPTC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 97.8180%-109 - C3 -2RKN 6.6 DIRL1_ARATH
11 HHSearch 95.8880%-106 - C3 -2RKN - DIRL1_ARATH -
34 SP3 63.1522%-117 - C3 -1HSS - IAA1_WHEAT -
17 HHSearch 61.5232% -80 - C3 -1SIY - NLTP1_VIGRR -
19 HHSearch 60.5030% -90 - C3 -2ALG - NLTP1_PRUPE -
18 HHSearch 60.2428% -86 - C3 -1T12 - NLTP1_TOBAC -
32 SP3 59.3721% -83 - C3 -1FK5 - NLTP_MAIZE -
16 HHSearch 57.9724% -76 - C3 -1BWO - NLTP1_WHEAT -
23 HHSearch 57.9227% -78 - C3 -1HSS - IAA1_WHEAT -
24 HHSearch 56.8824% -82 * C3 *1BEA - ITRF_MAIZE -
27 HHSearch 56.5925% -88 - C3 -1SM7 - ? -
37 SP3 55.9822% -95 - C3 -1BEA - ? -
39 SP3 55.8227% -85 - C3 -1S6D - 2SS8_HELAN -
40 SP3 55.1215%-119 - C3 -1K6K - CLPA_ECOLI -
12 HHSearch 54.7727% -90 - C3 -1N89 - NLT2G_WHEAT -
33 SP3 54.6125% -85 - C3 -1L6H - NLTPX_ORYSJ -
2 Fugue 54.2726% -73 - C3 -1L6H - NLTPX_ORYSJ -
13 HHSearch 53.7025% -83 - C3 -1L6H - NLTPX_ORYSJ -
14 HHSearch 52.3524% -59 - C3 -1AFH - NLTP_MAIZE -
22 HHSearch 51.5927% -76 - C3 -1S6D - 2SS8_HELAN -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
46 97.19100%-132 - C- -M046 - -
44 97.01100%-118 - C- -M044 - -
47 96.75100%-134 - C- -M047 - -
48 96.54100%-126 - C- -M048 - -