@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-03 )
ALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
29 SP3 92.2550%-130 - C2 -1FK5 4.7 NLTP_MAIZE
13 HHSearch 90.2450%-121 - C2 -1AFH - NLTP_MAIZE -
11 HHSearch 89.9856%-130 - C2 -1T12 - NLTP1_TOBAC -
12 HHSearch 89.3754%-129 - C2 -2ALG 3.8 NLTP1_PRUPE
15 HHSearch 87.6755%-130 - C2 -1SIY - NLTP1_VIGRR -
16 HHSearch 79.1339%-133 - C2 -1BWO - NLTP1_WHEAT -
22 HHSearch 62.4322%-170 - C2 -1BEA - ITRF_MAIZE -
26 HHSearch 57.2625%-150 - C2 -1SM7 - ? -
36 SP3 53.2318%-144 * C2 *1HSS - IAA1_WHEAT -
28 HHSearch 51.7123%-123 - C2 -1S6D - 2SS8_HELAN -
21 HHSearch 49.8616%-149 - C2 -1B1U - IAAT_ELECO -
5 Fugue 48.9622% -83 - C2 -1PSY - 2SS_RICCO -
24 HHSearch 47.4523% -96 - C2 -1PSY - 2SS_RICCO -
37 SP3 47.2414%-105 - C2 -1QPO - NADC_MYCTU -
17 HHSearch 45.8120%-126 - C2 -2RKN - DIRL1_ARATH -
9 Fugue 45.2823%-105 - C2 -1HSS - IAA1_WHEAT -
2 Fugue 44.2121% -97 - C2 -2RKN - DIRL1_ARATH -
34 SP3 43.1215% -97 - C2 -1QPO - NADC_MYCTU -
3 Fugue 42.4627% -85 - C2 -1L6H - NLTPX_ORYSJ -
32 SP3 41.7620% -90 - C2 -1L6H - NLTPX_ORYSJ -


User Run . : Multi Template Modeling Result:

(5 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
45 94.81100%-147 - C- -M045 - -
43 94.41100%-139 - C- -M043 - -
46 94.10100%-137 - C- -M046 - -
40 93.24100%-136 - C- -M040 - -
39 91.73100%-138 - C- -M039 - -