@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-03 )
ALSCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




11 SP3 93.2649%-137 - C2 -1FK5 4.5 NLTP_MAIZE
21 HHSearch 92.2054%-132 - C2 -1T12 - NLTP1_TOBAC -
25 HHSearch 91.5052%-138 - C2 -1SIY - NLTP1_VIGRR -
23 HHSearch 91.3454%-136 - C2 -2ALG 3.8 NLTP1_PRUPE
20 HHSearch 89.5549%-132 - C2 -1AFH - NLTP_MAIZE -
24 HHSearch 85.0642%-141 - C2 -1BWO - NLTP1_WHEAT -
39 HHSearch 59.4517%-159 - C2 -1HSS - IAA1_WHEAT -
29 HHSearch 58.7017%-171 - C2 -1BEA - ITRF_MAIZE -
37 HHSearch 55.9722%-153 - C2 -1SM7 - ? -
31 HHSearch 55.3221%-137 - C2 -1S6D - 2SS8_HELAN -
3 Fugue 54.7120% -91 - C2 -1PSY - 2SS_RICCO -
32 HHSearch 49.7818%-130 - C2 -2LVF - ? -
33 HHSearch 49.4012%-152 - C2 -1B1U - IAAT_ELECO -
34 HHSearch 49.1521%-103 - C2 -1PSY - 2SS_RICCO -
18 SP3 48.8013%-144 - C2 -1HSS - IAA1_WHEAT -
26 HHSearch 48.4920%-122 - C2 -2RKN - DIRL1_ARATH -
8 Fugue 47.8829%-104 - C2 -1L6H - NLTPX_ORYSJ -
4 Fugue 46.5713% -64 - C2 -1W2Q - CONG_ARAHY -
12 SP3 45.9521%-108 - C2 -1L6H - NLTPX_ORYSJ -
2 Fugue 45.6121% -98 - C2 -2RKN - DIRL1_ARATH -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]




OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]




41 96.75100%-151 - C- -M041 - -
40 95.46100%-145 - C- -M040 - -
47 93.59100%-151 - C- -M047 - -
46 93.38100%-150 - C- -M046 - -