@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-04 )
VTCGQVVGAVAPCLGYLRNGGTPPQPCCTGVRGLRNAARTTSDRKTICNCLKSASSSYRGVSGNYAASLPGKCGVNLPYKISPSTDCNRIQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
24 HHSearch 96.5559%-126 - C2 -1T12 - NLTP1_TOBAC -
23 HHSearch 94.3756%-120 - C2 -1SIY - NLTP1_VIGRR -
21 HHSearch 94.2856%-125 - C2 -2ALG 4.0 NLTP1_PRUPE
11 SP3 88.6054%-112 - C2 -1FK5 6.1 NLTP_MAIZE
26 HHSearch 88.2747%-120 - C2 -1BWO - NLTP1_WHEAT -
22 HHSearch 86.0355%-112 - C2 -1AFH - NLTP_MAIZE -
20 SP3 67.2920%-131 - C2 -1HSS - IAA1_WHEAT -
38 HHSearch 66.7725%-136 - C2 -1HSS - IAA1_WHEAT -
36 HHSearch 57.6427%-115 - C2 -1SM7 - ? -
33 HHSearch 57.1617%-129 - C2 -1BEA - ITRF_MAIZE -
14 SP3 54.5518%-116 - C2 -1QPO - NADC_MYCTU -
27 HHSearch 53.7029%-105 - C2 -2RKN - DIRL1_ARATH -
17 SP3 52.6218%-114 - C2 -1QPO - NADC_MYCTU -
2 Fugue 50.5427% -78 - C2 -2RKN - DIRL1_ARATH -
35 HHSearch 50.0022% -73 - C2 -1PSY - 2SS_RICCO -
3 Fugue 47.5623%-108 - C2 -1L6H - NLTPX_ORYSJ -
32 HHSearch 46.2313% -99 - C2 -1B1U - IAAT_ELECO -
13 SP3 42.9920% -81 - C2 -1L6H - NLTPX_ORYSJ -
28 HHSearch 42.1230% -68 - C2 -1L6H - NLTPX_ORYSJ -
34 HHSearch 41.8222% -61 - C2 -3OB4 - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
40 99.86100%-141 - C- -M040 - -
43 93.51100%-126 - C- -M043 - -
44 93.11100%-124 - C- -M044 - -