@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-05 )
AITCQQVTVAVTPCIGYARTGGTMPPDCCNGVRNLNSAAKNTPDRQQACICLKQMSSIPGINMSIVSEIPAKCNVNIGYPIAMSTDCSKVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
23 HHSearch 93.7550%-134 - C3 -1T12 - NLTP1_TOBAC -
21 HHSearch 90.8455%-140 - C3 -2ALG 3.9 NLTP1_PRUPE
11 SP3 87.3250%-129 - C3 -1FK5 5.9 NLTP_MAIZE
22 HHSearch 85.8251%-128 - C3 -1AFH - NLTP_MAIZE -
26 HHSearch 83.3742%-142 - C3 -1BWO - NLTP1_WHEAT -
25 HHSearch 82.1541%-136 - C3 -1SIY - NLTP1_VIGRR -
38 HHSearch 57.1625%-163 - C3 -1HSS - IAA1_WHEAT -
35 HHSearch 56.8227%-130 - C3 -1SM7 - ? -
33 HHSearch 49.4216%-156 - C3 -1BEA - ITRF_MAIZE -
2 Fugue 44.5818% -97 - C3 -2RKN - DIRL1_ARATH -
15 SP3 43.7919% -69 - C3 -1HSS - IAA1_WHEAT -
36 HHSearch 43.4422% -77 - C3 -1PSY - 2SS_RICCO -
32 HHSearch 42.5319%-110 - C3 -1B1U - IAAT_ELECO -
27 HHSearch 40.6914% -91 - C3 -2RKN - DIRL1_ARATH -
34 HHSearch 39.3218% -94 - C3 -3OB4 - ? -
16 SP3 35.6912%-109 - C3 -1F1Z - TNSA_ECOLX -
14 SP3 35.6915% -85 - C3 -1L6H - NLTPX_ORYSJ -
8 Fugue 35.0913% -87 - C3 -1X2I - ? -
3 Fugue 34.5623% -83 - C3 -1L6H - NLTPX_ORYSJ -
7 Fugue 33.6912% -73 - C3 -2L1N - ? -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
39 98.46100%-154 - C- -M039 - -
45 96.31100%-146 - C- -M045 - -
43 92.94100%-143 - C- -M043 - -
46 91.41100%-149 - C- -M046 - -