@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-05 )
MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
14 HHSearch 95.44100%-120 - C2 -1SIY - NLTP1_VIGRR -
11 HHSearch 80.9759%-119 - C2 -2ALG 3.7 NLTP1_PRUPE
12 HHSearch 78.5956%-120 - C2 -1T12 - NLTP1_TOBAC -
32 SP3 77.3351%-121 - C2 -1FK5 5.4 NLTP_MAIZE
16 HHSearch 73.8639%-127 - C2 -1BWO - NLTP1_WHEAT -
13 HHSearch 70.3652%-111 - C2 -1AFH - NLTP_MAIZE -
28 HHSearch 56.6220%-145 - C2 -1HSS - IAA1_WHEAT -
26 HHSearch 55.7330%-118 - C2 -1SM7 - ? -
35 SP3 54.1219%-121 * C2 *1HSS - IAA1_WHEAT -
24 HHSearch 50.5117%-125 - C2 -1BEA - ITRF_MAIZE -
30 HHSearch 47.0318%-108 - C2 -1W2Q - CONG_ARAHY -
2 Fugue 44.8830% -64 - C2 -2RKN - DIRL1_ARATH -
17 HHSearch 44.5129% -95 - C2 -2RKN - DIRL1_ARATH -
31 HHSearch 43.8821% -95 - C2 -1S6D - 2SS8_HELAN -
21 HHSearch 41.9216%-118 - C2 -1B1U - IAAT_ELECO -
3 Fugue 39.9526% -76 - C2 -1L6H - NLTPX_ORYSJ -
29 HHSearch 38.9421% -83 - C2 -2LVF - ? -
41 SP3 37.3810% -97 - C2 -1O4U - ? -
38 SP3 35.898% -95 - C2 -1A0P - ? -
4 Fugue 35.8912% -57 - C2 -2KVC - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
43 96.55100%-132 - C- -M043 - -
42 94.45100%-131 - C- -M042 - -
46 91.97100%-133 - C- -M046 - -