@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-06 )
ITCGQASSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
21 HHSearch 92.0799%-115 - C2 -2ALG 3.4 NLTP1_PRUPE
11 SP3 81.7459%-101 - C2 -1FK5 5.5 NLTP_MAIZE
23 HHSearch 80.3353%-110 - C2 -1T12 - NLTP1_TOBAC -
26 HHSearch 79.0644%-113 - C2 -1BWO - NLTP1_WHEAT -
24 HHSearch 77.9058%-108 - C2 -1SIY - NLTP1_VIGRR -
22 HHSearch 75.9959%-102 - C2 -1AFH - NLTP_MAIZE -
35 HHSearch 61.5530%-126 - C2 -1SM7 - ? -
39 HHSearch 59.2927%-147 - C2 -1HSS - IAA1_WHEAT -
19 SP3 56.9223%-144 - C2 -1HSS - IAA1_WHEAT -
33 HHSearch 55.3524%-136 - C2 -1BEA - ITRF_MAIZE -
38 HHSearch 48.6223% -92 - C2 -2LVF - ? -
32 HHSearch 48.0519%-122 - C2 -1B1U - IAAT_ELECO -
6 Fugue 46.9022% -76 - C2 -1PSY - 2SS_RICCO -
27 HHSearch 46.7027% -93 - C2 -2RKN - DIRL1_ARATH -
34 HHSearch 46.1022% -79 - C2 -1PSY - 2SS_RICCO -
3 Fugue 44.3124% -77 - C2 -1L6H - NLTPX_ORYSJ -
13 SP3 44.2621% -74 - C2 -1L6H - NLTPX_ORYSJ -
2 Fugue 44.0428% -82 - C2 -2RKN - DIRL1_ARATH -
9 Fugue 43.7821% -90 - C2 -1S6D - 2SS8_HELAN -
14 SP3 43.7415%-101 - C2 -1QPO - NADC_MYCTU -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
41 93.32100%-124 - C- -M041 - -
45 92.48100%-125 - C- -M045 - -
44 91.16100%-121 - C- -M044 - -