Study : 358_tI_RICCO (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 3 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: DAO_E_5(2ALG) / Model_19(2ALG/A) = [4.1] Download814.8033.29ITCGQVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAANGIPGLQPKLAESLPGNCNVNIPYKISLSTNCQSIK
Complex: OLA_A_2(1FK5) / Model_11(1FK5/A) = [4.1] Download1242.4343.04ITCGQVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAANGIPGLQPKLAESLPGNCNVNIPYKISLSTNCQSIK
Complex: LPC_A_4(1BWO) / Model_22(1BWO/A) = [4.4] Download1551.6443.00ITCGQVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAANGIPGLQPKLAESLPGNCNVNIPYKISLSTNCQSIK
Consensus
[pKd Mean = 4.20]
-1202
(s=302)
39
(s=4)
ITCGQVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAANGIPGLQPKLAESLPGNCNVNIPYKISLSTNCQSIK