@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-07 )
AITCGQVASSLSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISGINFGLASGLPGKCGVSVPYKISPSTDCSKVT

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
11 HHSearch 94.2461%-119 - C3 -2ALG 3.7 NLTP1_PRUPE
13 HHSearch 93.6860%-117 - C3 -1T12 - NLTP1_TOBAC -
30 SP3 89.4356%-118 - C3 -1FK5 5.3 NLTP_MAIZE
16 HHSearch 88.1743%-126 - C3 -1BWO - NLTP1_WHEAT -
15 HHSearch 86.2153%-118 - C3 -1SIY - NLTP1_VIGRR -
12 HHSearch 85.7057%-106 - C3 -1AFH - NLTP_MAIZE -
7 Fugue 65.8025%-102 - C3 -1S6D - 2SS8_HELAN -
33 SP3 62.2518%-143 - C3 -1HSS - IAA1_WHEAT -
24 HHSearch 60.8724%-125 - C3 -1SM7 - ? -
28 HHSearch 57.6720%-155 - C3 -1HSS - IAA1_WHEAT -
8 Fugue 57.1520%-118 - C3 -1HSS - IAA1_WHEAT -
29 HHSearch 56.2425% -97 - C3 -2LVF - ? -
23 HHSearch 55.2719%-144 - C3 -1BEA - ITRF_MAIZE -
17 HHSearch 50.9626% -92 - C3 -2RKN - DIRL1_ARATH -
22 HHSearch 49.0416%-116 - C3 -1B1U - IAAT_ELECO -
2 Fugue 48.3425% -75 - C3 -2RKN - DIRL1_ARATH -
26 HHSearch 48.2625% -80 - C3 -1PSY - 2SS_RICCO -
9 Fugue 44.5818% -32 - C3 -1PSY - 2SS_RICCO -
4 Fugue 44.5725% -83 - C3 -1L6H - NLTPX_ORYSJ -
6 Fugue 43.1316% -67 - C3 -2OCC - COX5A_BOVIN -


User Run . : Multi Template Modeling Result:

(5 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
46 95.94100%-134 - C- -M046 - -
41 95.21100%-128 - C- -M041 - -
47 94.72100%-136 - C- -M047 - -
44 94.39100%-123 - C- -M044 - -
40 93.70100%-122 - C- -M040 - -