Study : 407_tI_VITVI (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 3 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: LPC_A_4(1BWO) / Model_26(1BWO/A) = [3.2] Download1245.2445.85TVTCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINYGLASGLPGKCGVSVPYKISPSTDCSKVT
Complex: DAO_E_5(2ALG) / Model_21(2ALG/A) = [3.7] Download743.8535.21TVTCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINYGLASGLPGKCGVSVPYKISPSTDCSKVT
Complex: OLA_A_2(1FK5) / Model_11(1FK5/A) = [5.1] Download1216.2647.76TVTCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINYGLASGLPGKCGVSVPYKISPSTDCSKVT
Consensus
[pKd Mean = 4.00]
-1068
(s=229)
42
(s=5)
TVTCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINYGLASGLPGKCGVSVPYKISPSTDCSKVT