@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 439_tII_HORVU: (2014-05-08 )
ADAGAGAACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
11 HHSearch 93.0478%-125 - C4 -1N89 5.0 NLT2G_WHEAT
12 HHSearch 79.6956%-130 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 79.5855%-130 - C4 -1L6H - NLTPX_ORYSJ -
25 SP3 78.4751%-130 - C4 -1L6H - NLTPX_ORYSJ -
2 Fugue 70.5830%-110 - C4 -2RKN - DIRL1_ARATH -
13 HHSearch 69.4030%-115 - C4 -2RKN - DIRL1_ARATH -
31 SP3 68.5318%-143 - C4 -1S6D - 2SS8_HELAN -
19 HHSearch 65.5731%-110 - C4 -1T12 - NLTP1_TOBAC -
16 HHSearch 64.7129% -94 - C4 -2ALG - NLTP1_PRUPE -
26 SP3 64.3620% -84 * C4 *1FK5 - NLTP_MAIZE -
18 HHSearch 62.7127% -96 - C4 -1AFH - NLTP_MAIZE -
20 HHSearch 57.4927%-114 - C4 -1HYP - HPSE_SOYBN -
6 Fugue 57.0229% -75 - C4 -1BWO - NLTP1_WHEAT -
7 Fugue 55.3314%-106 - C4 -1S6D - 2SS8_HELAN -
17 HHSearch 55.0220% -84 - C4 -1SIY - NLTP1_VIGRR -
14 HHSearch 54.8428% -57 - C4 -1BWO - NLTP1_WHEAT -
29 SP3 54.4617% -94 - C4 -1U78 - TC3A_CAEEL -
33 SP3 51.7216% -78 - C4 -1F9M - TRXF_SPIOL -
28 SP3 50.6118% -70 - C4 -1KNG - CYCY_BRADU -
3 Fugue 48.8926% -57 - C1 -4DTH - ? -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
42 96.96100%-126 - C- -M042 - -
40 36.74100% -2 - C- -M040 - -