@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 457_tII_MAIZE: (2014-05-08 )
ANPCNPAQLTPCAGPALFGGAVPPACCAQLRAQQGCLCGYARSPNYGSYIRSPNAARLFAICNLPMPRCR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
21 HHSearch 97.9948%-146 - C2 -1N89 5.0 NLT2G_WHEAT
22 HHSearch 82.7445%-112 - C2 -1L6H - NLTPX_ORYSJ -
11 SP3 82.2944%-112 - C2 -1L6H - NLTPX_ORYSJ -
1 Fugue 82.2944%-112 - C2 -1L6H - NLTPX_ORYSJ -
23 HHSearch 73.7330%-145 - C2 -2RKN - DIRL1_ARATH -
24 HHSearch 73.6738%-114 - C2 -2ALG - NLTP1_PRUPE -
2 Fugue 70.1031%-127 - C2 -2RKN - DIRL1_ARATH -
29 HHSearch 66.8531%-110 - C2 -1SIY - NLTP1_VIGRR -
28 HHSearch 66.7832% -90 - C2 -1T12 - NLTP1_TOBAC -
12 SP3 65.1024%-110 - C2 -1FK5 - NLTP_MAIZE -
31 HHSearch 64.2524%-131 - C2 -1HYP - HPSE_SOYBN -
27 HHSearch 63.2525%-115 - C2 -1AFH - NLTP_MAIZE -
26 HHSearch 60.6020%-119 - C2 -1BWO - NLTP1_WHEAT -
14 SP3 59.7715%-107 - C2 -1KNG - CYCY_BRADU -
9 Fugue 51.0714%-106 - C2 -2EP8 - PESC_HUMAN -
7 Fugue 48.6512%-111 - C2 -3FBI - MED31_YEAST -
13 SP3 46.178%-100 - C2 -1U78 - TC3A_CAEEL -
16 SP3 46.1610% -83 - C2 -1F9M - TRXF_SPIOL -
4 Fugue 42.6222%-103 * C1 *2LU7 - -
15 SP3 40.6511%-121 - C2 -1PS6 - PDXA_ECOLI -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
41 99.82100%-146 - C- -M041 - -
43 97.65100%-151 - C- -M043 - -
42 94.93100%-155 - C- -M042 - -