@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 465_tIV_VITVI: (2014-05-08 )
ATICNIDTSKLAECLPAVSGRSPPPPTKACCTALLSADLHCLCNYKSALPAFGINPALAMALPKKCGGSLPPNCKVDAEP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 96.8848%-129 - C3 -2RKN 5.5 DIRL1_ARATH
11 HHSearch 92.8449%-123 - C3 -2RKN - DIRL1_ARATH -
17 HHSearch 72.7735%-114 - C3 -2ALG - NLTP1_PRUPE -
15 HHSearch 70.3535%-117 - C3 -1T12 - NLTP1_TOBAC -
32 SP3 70.3130%-103 - C3 -1FK5 - NLTP_MAIZE -
13 HHSearch 70.0434% -90 - C3 -1SIY - NLTP1_VIGRR -
34 SP3 69.5922%-143 - C3 -1HYP - ? -
14 HHSearch 68.9129%-103 - C3 -1AFH - NLTP_MAIZE -
24 HHSearch 64.7522%-113 * C3 *1SM7 - ? -
29 HHSearch 63.8425%-109 - C3 -1BEA - ITRF_MAIZE -
16 HHSearch 61.3730% -96 - C3 -1BWO - NLTP1_WHEAT -
31 HHSearch 59.4222%-109 - C3 -1B1U - IAAT_ELECO -
18 HHSearch 57.8428% -99 - C3 -1N89 - NLT2G_WHEAT -
26 HHSearch 56.5323% -90 - C3 -2LVF - ? -
33 SP3 56.2930% -92 - C3 -1L6H - NLTPX_ORYSJ -
28 HHSearch 55.8720%-127 - C3 -1W2Q - CONG_ARAHY -
2 Fugue 54.1433% -79 - C3 -1L6H - NLTPX_ORYSJ -
5 Fugue 53.6716% -83 - C3 -1S6D - 2SS8_HELAN -
21 HHSearch 51.6821% -99 - C3 -1S6D - 2SS8_HELAN -
23 HHSearch 51.2921% -92 - C3 -1HSS - IAA1_WHEAT -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
43 99.54100%-150 - C- -M043 - -
45 98.87100%-150 - C- -M045 - -
46 95.91100%-139 - C- -M046 - -
44 95.04100%-141 - C- -M044 - -