@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 467_tIV_VITVI: (2014-05-09 )
FSLCNMSEDDLMTCKPAVSKPSPVDPSPECCKALSGADLTCLCSYKNSETLPFLGIDPDLAMALPSKCNLTPPASC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 96.4653%-110 - C4 -2RKN 5.5 DIRL1_ARATH
11 HHSearch 95.6255%-109 - C4 -2RKN - DIRL1_ARATH -
34 SP3 69.4521%-112 - C4 -1HSS - IAA1_WHEAT -
32 SP3 62.7021% -76 - C4 -1FK5 - NLTP_MAIZE -
18 HHSearch 59.5526% -87 - C4 -1T12 - NLTP1_TOBAC -
19 HHSearch 59.3630% -89 - C4 -2ALG - NLTP1_PRUPE -
17 HHSearch 57.5632% -71 - C4 -1SIY - NLTP1_VIGRR -
35 SP3 57.5521%-117 - C4 -1HYP - ? -
38 SP3 56.8923% -98 - C4 -1BEA - ? -
12 HHSearch 55.4230% -94 - C4 -1N89 - NLT2G_WHEAT -
23 HHSearch 52.3120% -64 - C4 -1HSS - IAA1_WHEAT -
14 HHSearch 52.2225% -63 - C4 -1AFH - NLTP_MAIZE -
27 HHSearch 51.0824% -60 * C4 *1BEA - ITRF_MAIZE -
28 HHSearch 50.2821% -60 - C4 -1B1U - IAAT_ELECO -
24 HHSearch 49.1624% -81 - C4 -3OB4 - ? -
16 HHSearch 48.7922% -55 - C4 -1BWO - NLTP1_WHEAT -
10 Fugue 48.1918% -51 - C4 -1W2Q - CONG_ARAHY -
37 SP3 48.0026% -82 - C4 -1S6D - 2SS8_HELAN -
25 HHSearch 47.9422% -67 - C4 -1SM7 - ? -
13 HHSearch 46.6624% -75 - C4 -1L6H - NLTPX_ORYSJ -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
42 97.02100%-130 - C- -M042 - -
44 95.31100%-121 - C- -M044 - -
48 94.97100%-130 - C- -M048 - -
46 93.06100%-132 - C- -M046 - -