@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 468_tIV_PICSI: (2014-05-09 )
GGVVEICNVSKDDLMPCKPAVTQPPAQPVQACCSVLSTANLTCFCEFGNNYPSLLRMFGIDPDLAKALPGECKLNSPPGC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
11 HHSearch 96.3043%-132 - C4 -2RKN - DIRL1_ARATH -
1 Fugue 95.0543%-122 - C4 -2RKN 6.3 DIRL1_ARATH
23 HHSearch 71.8423%-105 - C4 -1BEA - ITRF_MAIZE -
18 HHSearch 70.3126%-107 - C4 -1T12 - NLTP1_TOBAC -
19 HHSearch 70.2232%-105 - C4 -2ALG - NLTP1_PRUPE -
25 HHSearch 70.1124% -91 - C4 -2LVF - ? -
13 HHSearch 69.3229% -89 - C4 -1SIY - NLTP1_VIGRR -
38 SP3 68.8423%-118 - C4 -1BEA - ? -
32 SP3 66.9618% -91 - C4 -1FK5 - NLTP_MAIZE -
41 SP3 65.8223%-101 - C4 -1S6D - 2SS8_HELAN -
35 SP3 64.9817%-124 * C4 *1HSS - IAA1_WHEAT -
28 HHSearch 64.7324% -83 - C4 -1SM7 - ? -
2 Fugue 63.7630% -82 - C4 -1L6H - NLTPX_ORYSJ -
24 HHSearch 63.2318%-103 - C4 -1HSS - IAA1_WHEAT -
15 HHSearch 63.1424% -81 - C4 -1AFH - NLTP_MAIZE -
12 HHSearch 62.7827%-107 - C4 -1N89 - NLT2G_WHEAT -
17 HHSearch 61.6026% -74 - C4 -1BWO - NLTP1_WHEAT -
14 HHSearch 60.8930%-109 - C4 -1L6H - NLTPX_ORYSJ -
21 HHSearch 60.3625% -83 - C4 -1S6D - 2SS8_HELAN -
34 SP3 59.8116%-136 - C4 -1HYP - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
48 42.62100% -7 - C- -M048 - -
46 34.19100% 16 - C- -M046 - -
44 30.06100% 12 - C- -M044 - -