@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 494_tIV_RICCO: (2014-05-09 )
LTLCDMNDDGLLACKPSVTKPDPVEPPSPACCQALTGANLTCLCSYRNSLMLPSLGIDPDLALGLPSKCNLTPPADC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 92.3947%-122 - C3 -2RKN 5.7 DIRL1_ARATH
11 HHSearch 90.6148%-122 - C3 -2RKN - DIRL1_ARATH -
30 HHSearch 71.1228%-103 - C3 -1BEA - ITRF_MAIZE -
32 SP3 67.6823% -78 - C3 -1FK5 - NLTP_MAIZE -
27 HHSearch 66.0624% -87 - C3 -1B1U - IAAT_ELECO -
23 HHSearch 64.5325%-114 - C3 -1SM7 - ? -
19 HHSearch 63.9832% -92 - C3 -2ALG - NLTP1_PRUPE -
18 HHSearch 63.0126% -91 - C3 -1T12 - NLTP1_TOBAC -
24 HHSearch 62.7729%-135 - C3 -3OB4 - ? -
34 SP3 62.5923%-116 - C3 -1HSS - IAA1_WHEAT -
6 Fugue 60.4425% -80 - C3 -1S6D - 2SS8_HELAN -
39 SP3 59.9325%-104 - C3 -1BEA - ? -
26 HHSearch 58.2323% -80 * C3 *1HSS - IAA1_WHEAT -
17 HHSearch 58.1727% -80 - C3 -1SIY - NLTP1_VIGRR -
36 SP3 57.2125% -88 - C3 -1S6D - 2SS8_HELAN -
12 HHSearch 53.6425% -88 - C3 -1N89 - NLT2G_WHEAT -
37 SP3 52.8920%-153 - C3 -1HYP - ? -
21 HHSearch 52.7624% -87 - C3 -1S6D - 2SS8_HELAN -
28 HHSearch 51.0820%-103 - C3 -1W2Q - CONG_ARAHY -
25 HHSearch 51.0426% -95 - C3 -2LVF - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
44 94.89100%-129 - C- -M044 - -
42 94.50100%-136 - C- -M042 - -
47 91.24100%-144 - C- -M047 - -