@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 497_tIV_RICCO: (2014-05-09 )
QSVCNVPISGLMACKPAVTPPNPSAPTSACCSALTHADMRCLCSYKNSNVLPSLGIDPNLALQLPPKCKLPRPNC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
20 HHSearch 98.4748%-151 - C3 -2RKN - DIRL1_ARATH -
1 Fugue 98.4648%-151 - C3 -2RKN 5.6 DIRL1_ARATH
14 SP3 71.9326%-128 - C3 -1HSS - IAA1_WHEAT -
28 HHSearch 68.8035%-123 - C3 -2ALG - NLTP1_PRUPE -
34 HHSearch 65.0726%-102 * C3 *1BEA - ITRF_MAIZE -
27 HHSearch 62.1326%-109 - C3 -1T12 - NLTP1_TOBAC -
31 HHSearch 60.4527% -94 - C3 -1HSS - IAA1_WHEAT -
11 SP3 58.4122% -90 - C3 -1FK5 - NLTP_MAIZE -
25 HHSearch 58.3930%-104 - C3 -1SIY - NLTP1_VIGRR -
23 HHSearch 57.6322% -98 - C3 -1BWO - NLTP1_WHEAT -
37 HHSearch 56.3322% -79 - C3 -1B1U - IAAT_ELECO -
21 HHSearch 52.8127%-108 - C3 -1N89 - NLT2G_WHEAT -
2 Fugue 52.7227% -90 - C3 -1L6H - NLTPX_ORYSJ -
35 HHSearch 52.1524% -81 - C3 -2LVF - ? -
15 SP3 51.2916%-119 - C3 -1HYP - ? -
13 SP3 49.2321%-103 - C3 -1S6D - 2SS8_HELAN -
39 HHSearch 49.0022% -86 - C3 -1SM7 - ? -
12 SP3 48.3024% -99 - C3 -1L6H - NLTPX_ORYSJ -
22 HHSearch 48.2527% -88 - C3 -1L6H - NLTPX_ORYSJ -
29 HHSearch 46.4021% -91 - C3 -1S6D - 2SS8_HELAN -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
46 91.67100%-167 - C- -M046 - -
45 90.72100%-158 - C- -M045 - -
47 90.05100%-156 - C- -M047 - -