@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 504_tIV_ANACO: (2014-05-09 )
ADDDAVLLCNMTRGGLEACKPSVRSGSSDPAADPSKECCAALAGADLPCLCSYRHSFLLPSLGIDPDLALQLPAKCNLTATPGC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
11 HHSearch 84.3145%-115 - C5 -2RKN - DIRL1_ARATH -
1 Fugue 83.9845%-116 - C5 -2RKN 6.1 DIRL1_ARATH
34 SP3 76.3521%-115 - C5 -1HSS - IAA1_WHEAT -
26 HHSearch 74.9824% -97 - C5 -1HSS - IAA1_WHEAT -
25 HHSearch 74.9824%-102 - C5 -1SM7 - ? -
27 HHSearch 73.4626% -99 - C5 -1BEA - ITRF_MAIZE -
32 SP3 73.4219% -98 - C5 -1FK5 - NLTP_MAIZE -
15 HHSearch 72.2327% -97 - C5 -1SIY - NLTP1_VIGRR -
29 HHSearch 70.6327% -85 - C5 -2LVF - ? -
36 SP3 69.5825% -85 - C5 -1BEA - ? -
6 Fugue 68.0020% -92 - C5 -1W2Q - CONG_ARAHY -
30 HHSearch 67.6821% -82 * C5 *1B1U - IAAT_ELECO -
19 HHSearch 66.9023% -94 - C5 -1T12 - NLTP1_TOBAC -
8 Fugue 66.5424%-103 - C5 -1S6D - 2SS8_HELAN -
24 HHSearch 63.9520%-104 - C5 -1W2Q - CONG_ARAHY -
18 HHSearch 63.9528%-107 - C5 -2ALG - NLTP1_PRUPE -
12 HHSearch 63.0129%-111 - C5 -1N89 - NLT2G_WHEAT -
22 HHSearch 61.6526% -98 - C5 -1S6D - 2SS8_HELAN -
20 HHSearch 60.7130%-134 - C5 -2DS2 - ? -
23 HHSearch 60.4124%-144 - C5 -3OB4 - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
41 43.25100% -24 - C- -M041 - -
44 30.74100% 30 - C- -M044 - -
43 30.59100% 30 - C- -M043 - -