@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 529_tII_ORYSI: (2014-05-10 )
GVVGVAGASCNAGQLTVCAGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
12 HHSearch 91.1297%-138 - C3 -1L6H - NLTPX_ORYSJ -
1 Fugue 91.1297%-138 - C3 -1L6H - NLTPX_ORYSJ -
24 SP3 89.1788%-138 - C3 -1L6H - NLTPX_ORYSJ -
11 HHSearch 83.7461%-122 - C3 -1N89 6.1 NLT2G_WHEAT
13 HHSearch 67.6028%-103 - C3 -2RKN - DIRL1_ARATH -
2 Fugue 67.5526%-103 - C3 -2RKN - DIRL1_ARATH -
15 HHSearch 62.3932% -85 - C3 -2ALG - NLTP1_PRUPE -
29 SP3 60.6122%-136 - C3 -1S6D - 2SS8_HELAN -
25 SP3 60.1026% -85 * C3 *1FK5 - NLTP_MAIZE -
19 HHSearch 59.8029% -97 - C3 -1T12 - NLTP1_TOBAC -
18 HHSearch 59.7932% -71 - C3 -1AFH - NLTP_MAIZE -
14 HHSearch 56.3228% -66 - C3 -1BWO - NLTP1_WHEAT -
20 HHSearch 56.0425%-117 - C3 -1HYP - HPSE_SOYBN -
17 HHSearch 53.2226% -83 - C3 -1SIY - NLTP1_VIGRR -
4 Fugue 52.6517% -92 - C3 -1S6D - 2SS8_HELAN -
31 SP3 51.8417% -80 - C3 -1KNG - CYCY_BRADU -
30 SP3 47.8111% -93 - C3 -1U78 - TC3A_CAEEL -
27 SP3 47.8121% -70 - C3 -1XFL - TRXH1_ARATH -
8 Fugue 39.9115% -58 - C3 -1TDP - CB2I_CARML -
26 SP3 39.5013% -93 - C3 -1PS6 - PDXA_ECOLI -


User Run . : Multi Template Modeling Result:

(1 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
39 94.02100%-119 - C- -M039 - -